KEGG   Panthera tigris altaica (Amur tiger): 102956746
Entry
102956746         CDS       T02988                                 

Gene name
EPAS1
Definition
(RefSeq) endothelial PAS domain protein 1
  KO
K09095  hypoxia-inducible factor 2 alpha
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg05200  Pathways in cancer
ptg05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102956746 (EPAS1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    102956746 (EPAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102956746 (EPAS1)
   04131 Membrane trafficking [BR:ptg04131]
    102956746 (EPAS1)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102956746 (EPAS1)
Membrane trafficking [BR:ptg04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    102956746 (EPAS1)
SSDB
Motif
Pfam: PAS_3 PAS_11 HIF-1a_CTAD HIF-1 PAS PAS_9 PAS_4 Corona_I HLH
Other DBs
NCBI-GeneID: 102956746
NCBI-ProteinID: XP_007097919
Position
Un
AA seq 874 aa
MTTDKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEAEANQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKGKDMSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVKVYNSCPPHSTLCSFKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTE
SLFKPHLTAMSSIFDSSSEVAVSEQSDYLFTKLKEEPEELAQLAPTAGDAIIALDFGSQN
FEKSSAYSSALLPPSQPWSRELRSHSTQSEAGSLPAFTVPQAAASGSATPSATSSSSCST
PSSPGDYYTSLNDDLKIEVIEKLFTIDTEAKDQGSTQTDFSELDLETLAPYIPMDGEDFQ
LSPICPEERLLQEKPQSTPQHCFSTMTNIFQPLAPVASHSPFLLDKYQQQLGSKKIEPEH
RPLSSIFFDGGSKVSLPTCCGQAGTPLSSLGGRSSSTQWPPDPPLHFGPTKWPVVDQHTE
SLGPSPLGPPVNSPHLSVFKKKLGRSAKGFGPQGPDVMSPAMVALSNKLKLKRQREYEEQ
AFQDLSGIQGDPSGSSTSHQMWKRMKSLRGSMNCPLVPDKLLSASAPSDEFTQLPMRGAG
QPLRHLPPPPSAMSPRENTKSGFPPQCYAPQYQDYSLPSAPKVSGMASRLLGPSFEPYLL
PELTRYDCEVNVPVPGSSTLLQGGDLLRALDQAT
NT seq 2625 nt   +upstreamnt  +downstreamnt
atgacaactgacaaggagaagaaaaggagcagctcggagaggaggaaggagaagtcccgg
gatgctgcccggtgccgacggagcaaggagacggaggtcttctacgagctggcccacgag
ctgcccctgcctcacagcgtgagctcccacctggacaaagcctccatcatgcggctggcc
atcagcttcctgcgcacacacaagctcctgtcctcagtttgctctgaaaatgagtctgaa
gctgaggctaaccaacagatggacaacttgtacctgaaagcgttggagggtttcattgcc
gtggtgacccaagatggcgacatgatctttctatcggaaaacatcagcaagttcatggga
ctcacacaggtggagctaacaggacacagtatctttgacttcactcatccctgtgaccac
gaggagattcgtgagaacctgagtctcaaaaatggctctggttttgggaagaaaggcaaa
gacatgtccacagagcgggacttcttcatgaggatgaagtgcaccgtcaccaacagaggc
cggaccgtcaacctcaagtcagccacctggaaggtcttgcactgcaccggccaggtgaag
gtgtacaacagctgcccccctcacagtactctgtgcagcttcaaggagcccctgctctcc
tgcctcatcatcatgtgcgaacccatccagcacccatcccacatggacatccccctggac
agcaagaccttcctgagccgccacagcatggacatgaagttcacctactgtgatgacaga
atcacagaactgattggttaccaccctgaggagctgctcggccgctcagcctatgagttc
taccatgccctggactcagagaacatgaccaaaagtcaccagaacctgtgcaccaaaggt
caggtggtgagtggccagtaccggatgcttgcaaagcatgggggctacgtgtggctggag
acccaggggacggtcatctacaaccctcgcaacctgcagccccagtgcatcatgtgtgtg
aactatgtcctgagcgagattgagaagaacgacgtggtgttctccatggaccagacggaa
tccctgttcaagccgcacctgacggccatgagcagcatctttgacagcagcagtgaggtg
gctgtgtctgagcagagtgactacctgttcaccaagctgaaggaggagccggaggagctg
gcccagctggcccccactgcgggggatgccatcattgccctggatttcgggagccagaac
tttgagaagtcctcagcctacagcagtgcccttctgcccccgagccagccgtggtccaga
gagctgaggagccacagcacccagagcgaggccgggagcctgcccgccttcaccgtgccc
caagcggctgcctccgggagcgccaccccaagtgccaccagcagcagcagctgctccacg
cccagcagccccggagactattacacatctctgaatgatgatctgaagattgaagtgatc
gagaagctcttcaccatagatacagaggcaaaggaccagggcagcacccagacggacttc
agtgagctggacttggagaccctggccccctacatccccatggacggggaagacttccag
ctcagtcccatctgccccgaggagaggcttctgcaggagaagccccagtcgactccccag
cactgctttagcaccatgacgaacatcttccagccgctggcacctgtggcctcccacagc
cctttcctcttggacaagtatcaacagcagctgggaagcaagaagatagagcctgagcac
cggcccctgtcctccatcttctttgatggcggcagtaaagtgtccctgcccacgtgctgt
ggccaagccggcacccctctctcctccctgggaggcaggtccagcagcacacagtggccc
cctgatccgccattacattttgggcccacgaagtggcctgttgtggatcagcacacggag
tccttggggccatcaccgttggggccccccgtcaactcaccccatctctccgtcttcaag
aaaaagcttggcaggtctgcaaaaggctttgggccccagggcccggatgtgatgagcccg
gccatggtagccctgtccaacaagctgaagctgaagcgacagcgagaatatgaggagcag
gccttccaggacctgagcgggatccagggggacccatcaggcagcagcacttcacatcag
atgtggaaaaggatgaagagcctcaggggcagcatgaactgccctttggtgcccgacaag
ttgctgagtgcaagcgcccccagtgatgagttcacccaacttcccatgaggggtgcggga
cagcctctgagacatctgccaccgccgccgtctgccatgagccccagggagaacaccaag
agtgggttccccccacagtgctacgcaccccagtaccaagactacagcctgccgtcagct
cccaaggtgtcaggcatggcgagtcggctgcttgggccctcctttgagccctacctgctg
cccgaattgaccagatatgactgtgaggtgaatgttcctgtgccaggaagctccacgctc
ctgcaaggaggggacctcctcagagccctggaccaggccacctga

DBGET integrated database retrieval system