KEGG   Panthera tigris altaica (Amur tiger): 102958180Help
Entry
102958180         CDS       T02988                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy related 16 like 1
  KO
K17890  autophagy-related protein 16-1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04136  Autophagy - other
ptg04140  Autophagy - animal
ptg04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102958180 (ATG16L1)
   04136 Autophagy - other
    102958180 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102958180 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102958180 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:ptg03029]
    102958180 (ATG16L1)
Membrane trafficking [BR:ptg04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    102958180 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    102958180 (ATG16L1)
Mitochondrial biogenesis [BR:ptg03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    102958180 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 eIF2A Nup160 ERM Ge1_WD40 Fez1 TolB_like V_ATPase_I KASH_CCD DUF2332 Lebercilin Spc7 Phage_GPO
Motif
Other DBs
NCBI-GeneID: 102958180
NCBI-ProteinID: XP_007083042
Position
Un
AA seq 523 aa AA seqDB search
MAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQQKDREMQMNEAKIAECLQTISDLETE
CQELRGKLQDLERANQTLKDEYDALQITFTALEEKLRKTTEENQELVTRWMAEKAQEANR
LNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHAEETSPVRAISRAA
TKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSSKEVRVPTTAICVFDAHDGE
VNAVQFSPGSRLLATGGMDRRVKLWEVFGDKCEFKGSLSGSNAGITSIEFDSAGSYLLAA
SNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIK
TVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKVTALDLNPERTELL
SCSRDDLLKIIDLRVNAVRQTFSAPGFKCGSDWTRVVFSPDGGYVAAGSAEGSLYVWSVL
SGKVEKVLSKQHGSSINAVAWSPSGSHVVSVDKGSKAVLWSEY
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctgaggattaaacaccaagaagaactgactgaattacacaagaaacgtggg
gagttagctcagttggtgattgacctgaataaccaaatgcagcagaaggacagggagatg
cagatgaatgaagcaaaaattgcagagtgcttgcagaccatctctgacctggagacggag
tgccaagaactgcgcggtaagcttcaggacctcgaaagagccaaccagaccctgaaggat
gagtatgatgccctgcagatcacgtttactgccttggaggagaaactgaggaaaactact
gaagagaaccaggagctggtcaccagatggatggccgagaaagcccaggaagccaaccgc
ctcaatgcagagaatgagaaggattcaaggcggcggcaagcccggctgcagaaagagctt
gcagaagcggcgaaggaacctctacccgttgaacaggatgatgacattgaagtcatcgtg
gatgaaacctctgatcacgccgaggagacttctcctgtgcgagccatcagcagagcggcc
actaagcgactctcgcagcctgctggaggccttctggattctatcactaatatctttggg
aggcgctctgtctcttcctttccagttccccaggataacgtggatactcatcctggttct
agtaaagaagtgagggtgccaacgaccgccatatgtgtctttgacgctcatgatggggaa
gtcaacgctgtgcagttcagtccgggctcccggttgctggccacaggaggcatggatcgg
agagttaagctttgggaagtgtttggagataaatgtgagttcaagggctccctgtctggc
agtaatgcaggaattacaagcattgaatttgacagtgctggatcttacctcttagcagct
tcaaatgattttgcaagtcgaatctggactgtggatgattatcggttacggcacacgctc
acaggacacagcggcaaagtgctgtctgccaagttcctgctggacaatgcgcgcattgtt
tccggaagtcatgaccggaccctcaagctctgggatctccgcagcaaagtctgcataaag
accgtgtttgcgggatccagctgcaatgatatcgtctgcacagagcagtgtgtgatgagt
ggacacttcgacaagaaaattcgtttctgggacatccgatcggagagcatcgtccgggag
atggagctgctgggcaaggtcactgccctggacttaaacccggagagaaccgaactcctc
agctgctctcgcgatgatcttctaaaaatcatcgatctgcgagtaaacgccgtcagacag
acgtttagcgcccctgggttcaagtgcggctctgattggaccagagttgtgttcagcccc
gacggtggttacgtggcagcgggctcggctgagggctccctctacgtctggagcgtgctc
tcggggaaagtggagaaggtcctttcaaagcagcatggctcgtccatcaatgcggtggcg
tggtccccctccggctcccacgtggtcagtgtggacaaaggaagcaaagctgtgctgtgg
tcagaatattga

DBGET integrated database retrieval system