KEGG   Panthera tigris altaica (Amur tiger): 102958471Help
Entry
102958471         CDS       T02988                                 

Definition
(RefSeq) cytochrome P450 2B11-like
  KO
K07412  cytochrome P450 family 2 subfamily B [EC:1.14.14.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00140  Steroid hormone biosynthesis
ptg00590  Arachidonic acid metabolism
ptg00830  Retinol metabolism
ptg01100  Metabolic pathways
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102958471
   00590 Arachidonic acid metabolism
    102958471
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102958471
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102958471
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ptg00199]
    102958471
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     102958471
Cytochrome P450 [BR:ptg00199]
 Cytochrome P450, animal type
  CYP2 family
   102958471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 102958471
NCBI-ProteinID: XP_007086640
Position
Un
AA seq 225 aa AA seqDB search
MELSVVLLLAVLTGLLLLLARGHPKAHGRLPPGPRPLAFLGNILQMDRSGLLKSFLRLRE
KYGDVFTVYLGPRPVVMLCGIEAIREALVDQAEAFSGRGRVSAVEQIFQGYGVIFANGER
WKLLRRFSLATMKNFGMGKRSIEERIQEESQCVVEELRKTQGAFQDPTFLFHSMTANIIC
SIVFGTRFSYKDPKFLRLLDLFYQNFTLLSSFSSQVRELVWEAGV
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggagctcagcgtcgttctcctccttgctgtcctcacgggactcctgcttctgctggcc
aggggccacccgaaggcccatggccgcctcccgccaggcccccgtcctctggccttcttg
gggaatattctgcagatggacagaagtggcttactcaaatccttcctgaggctccgagag
aaatacggggatgtcttcacggtgtacctggggccaaggcctgtggtcatgctgtgtggg
atagaggccatacgggaggccctggtggaccaagctgaggccttctctggccgggggaga
gtgtctgctgtagaacaaatctttcaaggctatggtgtgatctttgccaacggggaacgc
tggaagctccttcggcgattctctctggccaccatgaagaacttcgggatggggaagcgg
agtatagaggagcggattcaggaggagtctcagtgtgtggtagaggaactgcggaaaacc
cagggagccttccaggaccccaccttccttttccactccatgactgccaacatcatctgc
tccattgtctttggaacacgctttagctacaaagatcccaagttcctgcggttgctggac
ttgttctaccagaacttcacgctcctcagctccttctccagccaggtcagggagctggtg
tgggaggctggtgtgtga

DBGET integrated database retrieval system