KEGG   Panthera tigris altaica (Amur tiger): 102959342Help
Entry
102959342         CDS       T02988                                 

Gene name
ICK
Definition
(RefSeq) intestinal cell kinase
  KO
K08828  intestinal cell (MAK-like) kinase [EC:2.7.11.22]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102959342 (ICK)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102959342 (ICK)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: CMGC group
  RCK family [OT]
   102959342 (ICK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 102959342
NCBI-ProteinID: XP_015399036
Position
Un
AA seq 632 aa AA seqDB search
MNRYTTIKQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHA
NVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHG
FFHRDLKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSTNYSSP
IDIWAVGCIMAEVYTLRPLFPGASEIDTIFKICQLLGTPKKTDWPEGYQLSSAMNFRWPQ
CVPNNLKTLIPNASSEAIQLLRDMLQWDPKKRPTASQALRYPYFQIGHPLGSTTQSLQDS
GKPQKDVLEKAGPPPHIKPIPPAQPPTKPHTRISSRQHQASQPPQHLMYPYKTEASRTDH
LNHLPEDKPSPLLFPSLHTKNPQSKMLAGLEHKNGEIKPKSRRRWGLVSRSTKDSDDWAD
LDDLDFSPSLSRMDLKNKKRQSEETLCRFESVLDLKPSEPIGTGNSAPTQTSYQRRDTPT
LRSAAKQHYLKHSRYLPGINIRNGILPNPGKDFIPSNPWSSSGLSGKSSGTVSVISKINS
VGSGSTSSSGLTGNYIPSFLKKEVGSAMQRVHLAPIPDPSPGYSSLKAVRPHPGRPFFHT
QPRSTPGLMPRPPAAQPVHGRTDWASKYASRR
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgaatagatacacaacgatcaagcaacttggggatggaacctatggttccgtcctactg
ggacgaagcattgagtctggggagctgattgctattaaaaaaatgaaaagaaagttttat
tcctgggaggaatgcatgaaccttcgggaggttaagtctttaaagaagctcaaccacgcc
aatgttgtaaaattaaaagaagttatcagggaaaatgatcatctttattttatcttcgag
tacatgaaggaaaatctttaccagctcattaaagaaagaaataagttgtttcctgaatct
gctataaggaatatcatgtatcagatattacaaggacttgcatttattcacaaacacggc
ttctttcatagggacttaaagcctgagaacctcctctgcatgggcccagaacttgtgaaa
attgcagacttcgggttggcccgagagatccgatcaagacccccatacacagactatgta
tccaccagatggtacagggctccagaagtgctcctgaggtctaccaactacagctccccc
attgacatctgggcagtgggctgcatcatggcagaagtgtacaccctcaggccactcttc
cctggggccagtgaaattgacaccatcttcaaaatttgccaactgttggggacaccgaaa
aagaccgactggcctgaaggctaccaactttcaagtgcaatgaacttccgctggccccag
tgcgtacccaataacttaaagaccctgattccaaatgctagcagtgaagccattcaactc
ctgagagacatgcttcagtgggatcccaagaaacggccaacagctagtcaggcgcttcga
tatccttacttccagattgggcatccgctgggcagcaccacacagagccttcaggattca
ggaaaaccacagaaggatgtcctggaaaaggcgggcccccctcctcacattaagccgatc
ccacctgcccagcccccaaccaagccacacacacggatttcttcgagacagcatcaggcc
agccagccccctcagcatctcatgtacccctacaaaacagaggcttccaggacagaccac
ctgaaccatcttccagaggacaagccaagcccgttgctcttcccgtccctccataccaag
aatcctcagtcgaaaatgctggctggcctggaacacaaaaatggggagatcaagccaaag
agtaggagaaggtggggtcttgtgtcccggtccacaaaggattccgatgactgggctgac
ttggatgacttggatttcagtccatccctcagcaggatggacctgaaaaacaagaagaga
cagagcgaagagaccctctgcagatttgagagtgttttggacctgaagccctctgagccc
atcggtacaggaaatagcgcccccacccagacctcttatcagaggcgagacaccccgacc
ctgaggtccgcggccaagcagcactacttgaagcactcccgatacttgcccggaataaat
ataagaaatggcatacttccaaatccaggcaaggatttcattccatctaacccatggtct
agttctggtttgtctggaaaatcttcagggacagtatcggtaatcagcaaaataaattca
gttggttccggctctacaagttctagtggactgactggaaactatatcccctcctttcta
aaaaaagaagttggttctgctatgcagagggtacacttggcacctattccagacccttcc
cctggctattcttccctgaaggccgtgagacctcatcctgggcgaccttttttccacacc
cagcctagaagcactcccgggttgatgccccggcctccggctgcccagccagtgcatggc
cggacggactgggcttctaagtacgcgtctcggcgatga

DBGET integrated database retrieval system