KEGG   Panthera tigris altaica (Amur tiger): 102960094
Entry
102960094         CDS       T02988                                 

Gene name
ASIC1
Definition
(RefSeq) acid sensing ion channel subunit 1
  KO
K04829  acid-sensing ion channel 1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102960094 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ptg04040]
    102960094 (ASIC1)
Ion channels [BR:ptg04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   102960094 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 102960094
NCBI-ProteinID: XP_007073062
Position
Un
AA seq 558 aa
MPIQIFCSVSFSSGEEAPGPLGDVWGPHQRRQQDKSESEEEEEKEKEAVRKKAREGDSPM
DLVAFANSCTLHGTSHIFVEGGPGPRQALWAVAFVLALGAFLCQVGDRVAYYLSYPHVTL
LDEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEAFS
GEPFNLHRFYNRSCHRLEDMLLYCSYCGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPRLK
TMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPG
FQTFVSCQEQRLIYLPPPWGTCKAVTMDSDFFDSYSITACRIDCETRYLVENCNCRMVHM
PGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYL
AKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTV
LELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTYA
ANILPHHPARGTFEDFTC
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgcccatccagatcttctgctctgtgtcattttcctctggagaggaagccccagggccc
ttgggagatgtttggggtccgcaccagcggcggcagcaggacaagtcagaatcagaagag
gaggaagagaaggaaaaggaggcagtgaggaagaaggctagagagggggattcgcccatg
gatttggtggcctttgccaacagctgcaccctgcatggcaccagccacatcttcgtggag
gggggtccagggccgaggcaggccctgtgggcagtggcctttgttctggcactgggtgcc
ttcttgtgccaggtaggggaccgcgttgcctattacctcagctacccacacgtgactctg
ctagacgaggtggccaccacggaactggccttcccggcggtcaccctctgcaacactaat
gctgtgcggctgtcccagctcagctaccccgacttgctctacctggcccccatgctgggg
ctggatgaaagtgacgaccctggggtgcctctggccccaccggggcctgaggccttctct
ggggagccctttaacctgcaccgcttctacaatcgctcttgccaccggctggaggacatg
ctgctctattgttcctactgcggggggccctgtggcccccacaacttctcggtggtcttc
acacggtatggaaagtgctacacattcaactcgggccgagatgggcgtccacggctgaag
accatgaagggtgggactggcaatgggctggagatcatgctggacatccagcaggacgag
tacctgcccgtatggggagagactgatgagacgtccttcgaagcgggcatcaaagtgcag
atccacagtcaggatgaacctcccttcatcgaccagctgggctttggtgtggccccaggg
ttccagacctttgtgtcctgccaggagcagcggctcatctacctgcccccgccctggggc
acctgcaaagctgttaccatggactcggatttcttcgactcctacagcataactgcctgc
cgcatcgactgtgagacacgctacctggtggagaactgtaactgtcgcatggtgcacatg
ccaggggatgccccatactgcactccagaacagtacaaggagtgtgcggatcctgctctg
gacttcctggtggagaaggaccaggaatactgtgtgtgtgaaatgccctgcaacctaacc
cgctacggcaaggagctgtccatggtcaagatccccagcaaagcgtcagccaagtacctg
gccaagaagttcaacaagtctgagcagtacataggggagaacatcctggtgctggacatt
ttctttgaagtcctcaactatgagactattgagcagaagaaggcctatgaaattgcaggg
ctcctgggtgacattggaggccagatgggcctgttcattggggccagcatcctcacagta
ctggagctctttgactacgcctatgaggtcattaagcacaagctgtgcagaagaggaaag
tgccagaaggaggccaaaaggagcagcgcggacaagggtgtggcccttagcctggatgac
gtcaaaagacataacccgtgtgagagcctccggggccatcctgctgggatgacgtatgct
gccaacatcctacctcaccatccggcccgaggcacttttgaggactttacctgctga

DBGET integrated database retrieval system