KEGG   Panthera tigris altaica (Amur tiger): 102960124
Entry
102960124         CDS       T02988                                 

Gene name
HIF3A
Definition
(RefSeq) hypoxia inducible factor 3 alpha subunit
  KO
K09096  hypoxia-inducible factor 3 alpha
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102960124 (HIF3A)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102960124 (HIF3A)
SSDB
Motif
Pfam: HIF-1 PAS_3 PAS_11 PAS PAS_4 PAS_9
Other DBs
NCBI-GeneID: 102960124
NCBI-ProteinID: XP_015398965
Position
Un
AA seq 663 aa
MPPPFPGWGPAPPALSRQEATLSPRRPGPGELTADTSGRGQRPLGTPRREARRWGQQAPA
RGQIKPAAGELPRSRGRLEGVDPWLTRHTPSTLALTPGEWNQVGAGGEALDACYLKALEG
FVMVLTAEGDMAYLSENVSKHLGLSQLELIGHSIFDFIHPCDQQELQDALTPRPSLSKKK
PEAPTERCFSLRMKSTLTSRGRTLNLKAATWKPAPQLPTLQGAPLPTQTPAPCSPRPKEP
SLPRLPPASPTPCSQSLLSPFAPSGALTPPRPPSPVLSKGQAVTGQYRFLARSGGYLWTQ
TEGTVVSGGRGPQSESIVCVHFLISRVEETGVVLSLEQTERHSRRPAQRGTPSQKDAPDP
GDSLDASGPRILAFLHPPALSEATLAADPRSFCSPDLRRLLAPILDGTSVAATPSAPPAT
RRPQSPLPADLPDEPLMDMENTHKLLASGKDLEAVETDLDIAQDVDALDLEMLAPYISMD
DDFQLNPSEQLPRAFRRPPGAVPRPRARSFHGLSPPTPEPSLLPRWGSDPRLSCSSPSRG
DPLASSPVAGARKRTLAQSSEDEAEGVELLGVKPPKRSPSPEPENFLLPPLSLEYLEQGC
MLPESTRPGRPAGTQRKGRTRLWRDTQRRAVCLGPPLLSLYADEDPVEPRSHFQPAAGLG
QAN
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgccccctcccttccctggctgggggccagctccgccggccctctcccggcaggaggcc
accctgtcccccaggcgtcccgggcccggggaattgacagcggatacgtcagggagggga
cagcggcccttaggcacgcctcggagagaagcaaggcgctgggggcagcaagcgccggcg
cgggggcagataaaacccgcggccggggagctgccccggagcagagggaggctggagggg
gtggatccatggctgactagacacaccccatccaccctggccctgacaccaggggagtgg
aaccaggtgggagcagggggagaagctctggatgcctgctacctgaaggccctggagggc
ttcgtcatggtgctcactgccgagggagacatggcttacctgtcggagaatgtcagcaaa
cacctgggcctcagtcagctggagctcatcggacacagcatctttgatttcatccacccc
tgtgaccaacaggagctccaggacgccctgaccccccggccgagtctgtccaaaaagaag
ccagaggcccccaccgagcggtgtttctctttgcgcatgaagagtaccctcaccagccgc
gggcgcaccctcaacctcaaggcggccacctggaagccggccccccagctccccacgctc
cagggagccccactcccaacccagacaccagctccctgctccccacgccccaaggaacct
tctcttccccggctccctcccgcatccccaaccccctgctcccagagcctcctctccccg
tttgccccttctggggccctgacccctccccgtcccccttccccagtgctgagcaagggc
caggcggtaacggggcagtatcgcttcctggcccggagtggtggctatctgtggacccag
actgagggcacagtggtgtcagggggccggggtccccagtctgagagcatcgtctgcgtc
cactttttgatcagccgggtagaagagaccggagtggtgctgtccctggagcaaaccgag
cgacactcccgcagacccgctcagcggggcaccccctcccagaaggacgcccctgatcct
ggggacagccttgatgcctctggtccccggatcctggccttcctgcacccccctgccctg
agcgaggccaccctggccgctgacccccgcagcttctgtagccctgacctccgtcgcctc
ctggcacctatcttggacgggacttcagtagctgccacccccagcgcacccccagccaca
cggcgcccccaaagccctcttccggccgatctgccagacgaaccactcatggacatggag
aatacacacaaactcttggcctctgggaaagaccttgaggctgtggagacagatctagat
atagctcaggatgtcgatgctctggatttggagatgctggccccctacatctccatggat
gatgacttccagctcaaccccagcgagcagctacccagggccttccgcagacctccaggc
gctgtcccccggccccgcgctcggagcttccatggcctgtcgcccccaacccctgagccc
tccctgctgccccgctgggggagtgacccccggctgagctgctccagcccttccagaggg
gaccctttggcatcgtcccccgtggctggggctcggaagaggaccctggctcagagctca
gaggacgaggccgagggggtggagctgctgggagtgaaaccccccaaacggtcccccagc
ccagaacccgaaaacttcctgctgcctcccctcagcctggaatacctagagcaaggctgc
atgttgccggaatccacccgcccaggtcggcctgctgggacacagaggaaggggcgaaca
aggctctggagggacacacagaggagagctgtctgcctgggtcccccgctgctctctctc
tacgcggacgaggaccccgtggagcccaggagccacttccaaccagcggcaggcttgggc
caggccaactga

DBGET integrated database retrieval system