KEGG   Panthera tigris altaica (Amur tiger): 102960328
Entry
102960328         CDS       T02988                                 

Gene name
NPAS2
Definition
(RefSeq) neuronal PAS domain protein 2
  KO
K09026  neuronal PAS domain-containing protein 2
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    102960328 (NPAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102960328 (NPAS2)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102960328 (NPAS2)
SSDB
Motif
Pfam: PAS_11 PAS_3 PAS HLH PAS_9
Other DBs
NCBI-GeneID: 102960328
NCBI-ProteinID: XP_007097846
Position
Un
AA seq 820 aa
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSILYVSDSITPLLGHL
PSDVMDQNLLNFLPEQEHSEVYKMLSSHMLVTDSPSPEYLKSDNDLEFYCHLLRGSLNPK
EFPTYEYIKFVGNFRSYNNVPSPSCNGFDGTLSRPCRVPLGKEVCFIATVRLATPQFLKE
MCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCH
QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVER
RQELALEDPPPEAIHPSALKDKGSSLDPQQHFNALDAGTLGLNTSHSPSVSSRSSHKSSH
TAMSEPASAPSKLMAEASTTALPRPATLPQELPVPGLSQAATMPAPLPAPSSCDLTQQLL
PQTILQNPPAPMTQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDS
NIQMFLQQPAVSLSFSSATRPDAQQQLQQRSAPASQPQLVASPQLPGQIASAQVANQHLL
RESSVISTQGPRPMRSSQMMQGSGHSVSSLTPQFSSTTAVLPPALSLTTLASASQDGSQC
QPSPDFGHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYPQSQAVFQNADMHTT
SSSTSPPVLLMGQAVPQPSFPAAASRQSPLQPAQAPQQAQHFLQVQAPTSLHSEQQDSLL
LSTYSQPPGTLGYPPPPQPPRPPRRVSSLSESSGLQQPPR
NT seq 2463 nt   +upstreamnt  +downstreamnt
atggatgaagatgagaaagacagggcaaagagagcttctcgaaacaagtctgagaagaag
cgtcgggaccagttcaatgttctcatcaaagagcttagctccatgctccctggcaacacg
cggaaaatggacaaaaccaccgtgctggaaaaggtcattggatttttacagaaacacaat
gaagtctcagcgcaaacggaaatctgtgatattcagcaagactggaagccttcattcctc
agtaatgaagaattcacccagctgatgttggaggcgttagacggcttcatcatcgcagtg
accacggatggcagcatcctctatgtttcagacagtatcacgcctctcctggggcattta
ccgtcagatgtcatggatcagaatttgttaaattttcttccagaacaagaacattcagaa
gtttataaaatgctctcttcccatatgcttgtgacagattccccctccccagaatactta
aaatctgacaacgatttagagttttattgccatcttctcagaggcagcttgaacccaaag
gaatttccaacttatgaatacataaaatttgtaggaaattttcgctcttacaacaatgtg
cctagcccttcttgtaatggctttgatggcaccctttcaaggccctgccgggtgccgctg
ggaaaggaggtctgcttcatcgccacagttcgtctggcaacaccacagttcttaaaggaa
atgtgcatagttgacgaacctttagaggaattcacttcaaggcatagcttggaatggaaa
tttttatttctggatcacagagcccctccgatcataggatacctgccttttgaagttttg
gggacctcaggctatgactactaccacattgacgatctggagctcctggccaggtgccat
cagcacttgatgcagtttggtaaagggaagtcctgttgctaccggttcctcaccaaaggc
cagcagtggatttggctgcagacgcattactacatcacttaccaccagtggaactccaag
cccgagttcatcgtgtgcacgcactcggtcgtcagttacgcagatgtccgggtagaaagg
aggcaggagctggctttggaagacccgccacccgaggccatccacccttcagcactcaag
gacaagggctccagcctggaccctcagcagcactttaacgcacttgacgcaggcaccttg
ggccttaacaccagtcattcaccatcagtgtcctccagaagctcccacaaatcctcgcac
acggccatgtcagaacccgcctctgccccaagcaagctgatggcagaggccagcaccacg
gctttgccgagaccagccaccctgccccaagagctccccgtgccagggctcagccaggca
gccacaatgccggctcccctgcctgccccgtcatcctgtgacctcacacagcagctcctg
cctcagaccattttgcagaacccacctgcccccatgacacagttctcagcacagttcagc
atgttccagaccatcaaagaccagctggagcagcggacacggatcctgcaagctaacatc
cgatggcagcaggaggagctccacaagatccaggagcagctctgcctggtccaggactcc
aatatccagatgttcctgcagcagccagctgtttccctgagcttcagcagcgcaacgcgg
cctgacgctcagcagcaactccagcagaggtcagccccagcctcccagccccagcttgtg
gccagccctcaactcccagggcagattgcctctgcccaggtggcaaaccagcacctgctc
agagaatcaagtgtgatatcaacccagggtccacggcctatgagaagctcacagatgatg
cagggaagtggccactcagtgagcagcttgacgccccagttcagcagcaccacggctgtg
ctcccaccagctctgagcctgaccacgcttgcttccgcctcccaggatggcagccagtgc
cagcccagcccagactttggtcatgatcggcagctcaggctattgctgagccagcccatc
cagcccatgatgcctgggtcctgtgatgcgaggcagccctcagaggtcagcaggactgga
cggcaagtcaagtatccgcagagccaggccgtgtttcaaaatgcagacatgcacaccacc
agcagcagcacctcgccccccgtcctgctgatgggacaggcggtgcctcagcccagcttc
cccgccgccgcctccaggcagtcacccctgcagcccgcacaggccccgcagcaggcacag
cacttcctgcaggtacaggcaccgacctctttgcacagtgagcagcaggactccctactt
ctctccacctactcgcaaccgccagggaccctgggctacccacccccaccccagccccca
cgcccaccccgaagggtcagcagcctgtctgagtcctcgggcctccagcagccgccccgg
tag

DBGET integrated database retrieval system