KEGG   Panthera tigris altaica (Amur tiger): 102960989Help
Entry
102960989         CDS       T02988                                 

Gene name
AOAH
Definition
(RefSeq) acyloxyacyl hydrolase
  KO
K01065  acyloxyacyl hydrolase [EC:3.1.1.77]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.77  acyloxyacyl hydrolase
     102960989 (AOAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_GDSL SapB_2 Lipase_GDSL_2 CLU_N
Motif
Other DBs
NCBI-GeneID: 102960989
NCBI-ProteinID: XP_007078637
Position
Un
AA seq 575 aa AA seqDB search
MKSPWNILLVTPLFLLLPLCTSASPASDDSPSTRNPNGHTCLACVAVVSVIEQLAQVHNS
TVETSMERLCSYLPEKLFLKTTCYLVIEMFGPDIIKLLSTDMNADVVCHTLKFCKQDPGQ
PLCHLYPLPKEAWKFTLEKARQIVKKSPALKYSRSSADICSLPFLAKICQKIKLAIKNSV
PFKDVDSDKYSVFPTLRGYHWRGRDCNDSNKMAYPGRRPDNWDVHEDSNCNGIWGVDPKD
GIPYEKKFCEGSQPRGIILLGDSAGAHFHISPEWITASQMSLKSFINLPTALTNELNWPQ
ISGATGFLDSISGIKEKSIYLRLRKRNHCNHRDYQNISRNGASSQNLDRFIESLSRDPLL
DHPAIIIYAMIGNDVCNGKADPVPEMTTPKKLYSSVMKTLKYLNSHLPNGSHVILYGLPN
GTFLWDNLHNRYYPLGQLNKDVTYAHFYSFLNCLQVSPCHSWMSSNKTLRNLTSERAKQL
SNTLKNIATSQKFTNFDLFYADFDFQEVTEEWQKRGGEPWQLIEPVDGFHPNEVALLLLA
DRLWKKVELHWPQVLGKENPFNPQIEQVFGDQGGH
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccccctggaatatccttttggtgactcctctgttcttactcctgccgctttgc
acctcggcgtctccagcctctgatgactccccaagcaccagaaaccccaatggccacacc
tgtctagcctgtgtggcggtggtatccgtgattgaacagcttgctcaagttcacaactcc
acggtggagacctcaatggagagactgtgcagctaccttcctgaaaagctgttcttgaag
acaacctgctatttagtgatagaaatgtttggaccagacatcataaaactgcttagcaca
gatatgaatgctgatgtggtgtgtcacaccctgaagttttgtaagcaggaccctggccaa
ccattgtgtcatctctacccacttcccaaggaggcatggaaatttacactagagaaggcg
agacagattgtcaagaagtccccagctctgaaatattccagaagcagtgctgatatttgt
tccctcccgtttttggccaagatctgtcagaagattaaattagctataaaaaattctgtg
ccattcaaagatgtagattcagacaaatacagtgtttttccaacgctgaggggctatcac
tggcgagggagggattgcaatgacagcaacaagatggcatacccgggcaggaggccagat
aactgggatgtacatgaggattcaaactgtaatggcatttggggtgttgatccaaaagat
ggaattccatatgagaagaagttctgtgaaggttcacagcccaggggaatcattttgcta
ggagactcagcaggggctcatttccacatctctcccgaatggatcacagcttcacagatg
tctttgaaatccttcatcaatttaccaacagctcttaccaatgagctcaactggccccaa
atctctggtgctactgggtttctggactccattagtggaattaaagaaaaatctatttac
cttcgcttacggaaaagaaaccactgcaatcacagagactaccagaatatttcaagaaat
ggtgcatcttcccaaaacctggacagatttatagaaagtttgtccagggacccactgttg
gatcatccagccatcattatatacgccatgattggaaatgatgtctgcaatgggaaagct
gacccagtcccagaaatgactactcctaagaaattatactccagtgtcatgaagactctg
aagtatctaaattcccacctgccaaatggcagccatgttattttatacggcttaccaaat
ggaacgtttctctgggataatttgcacaacagatattatcctctcggtcagctgaataag
gatgtgacctatgcacatttctactctttcctgaactgtctccaggtcagcccctgccac
agctggatgtcctccaacaagacactccggaatctcacttcagagagagcaaaacaactc
tccaatacactgaaaaatattgcaaccagccagaaatttacgaacttcgatcttttctat
gcagattttgacttccaagaagtgacagaggagtggcagaagagaggcggggagccctgg
cagctcattgaaccagtggatggattccaccccaatgaggtggctttgctgctgttggca
gatcgcttatggaagaaagtggaacttcattggccccaggttctgggaaaggagaatcca
ttcaaccctcagattgaacaggtgtttggagatcaagggggccactga

DBGET integrated database retrieval system