KEGG   Panthera tigris altaica (Amur tiger): 102961078Help
Entry
102961078         CDS       T02988                                 

Gene name
DBH
Definition
(RefSeq) dopamine beta-hydroxylase
  KO
K00503  dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00350  Tyrosine metabolism
ptg01100  Metabolic pathways
Module
ptg_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    102961078 (DBH)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     102961078 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu2_monoox_C DOMON Cu2_monooxygen
Motif
Other DBs
NCBI-GeneID: 102961078
NCBI-ProteinID: XP_015399858
Position
Un
AA seq 408 aa AA seqDB search
MHPVPSGPTPPAVHPLLLEQPRHQLEPSVYFQLLVQELKAGVLFGMSDRGELENADLVVL
WTDGHGTYFGDAWSDQRGQIHLDSRQDYQLLRARRTPKGLSLIFKRPFDTCDPKDYLIED
GTVHLVYGVLEEPFRTLEAVNTSGLQTGLQRVQLLKPSIPIPALPADTHTMEIRTPDILI
PDQPTTYWCHITELPDGFSRHHIVMAFYYPEEAGLAFGGAESSRFLRLEVHYHNPLKIQD
GQAKKKYSVRDHRPPGERRASGAAGRETRGPASKRRLPVVTGVAALPPSGIHIFASQLHT
HLTGRKVVTVLVRDGREREIVNRDDHYSTHFQEIRMLKKMVSVRPGDVLVTSCTYNTEDR
ELATVGGFGILEEMCVNYIHYYPQTQLELCKSTVDPGFLREYFHLVNR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcaccccgtgccatctggccccacccccccagcagtacacccactcctgctggagcag
cccaggcaccagctggagcctagcgtctacttccaactcctggtgcaggagctcaaggcc
ggtgtcctgtttgggatgtcggaccgcggcgagttggaaaatgctgacctggtggtgctc
tggaccgacggacacggcacctactttggggatgcctggagtgaccagaggggacagatc
cacctggattcccggcaggattaccagctgctgagggcacggagaaccccgaaaggcctg
agcctgatcttcaagaggccctttgacacctgtgaccccaaggattacctcattgaggat
ggcaccgtccacctggtttacggggtcctggaggagccgttccggacgctggaggccgtc
aacacctcggggctgcagacggggctgcagagggtacagctgttaaagcccagtatcccc
atcccggccttgcccgcggacacgcacaccatggagatccgcaccccggacatcctgatc
cccgaccagccgaccacatactggtgccacatcactgagcttccggacggcttctcccgg
caccacatcgtcatggccttttactacccggaggaagcaggccttgcctttgggggcgcc
gagtcctccagatttctccgtctggaagttcactaccacaacccgctgaagatccaagat
ggacaagccaagaaaaagtatagcgttcgagaccacaggcccccgggcgagcgacgagcc
tctggggccgcggggagagaaacccggggtcccgcaagcaagcggaggctgccagtcgtc
acaggcgtggccgccctgcctccctcagggatccacatcttcgcctcccagctccacaca
cacctgacggggaggaaggtggtcactgtgctggtccgggacggccgagagagggagatt
gtgaacagggacgaccactacagcactcacttccaggagatccgcatgttgaagaagatg
gtgtccgtgcgcccgggggacgtgctcgtcacttcctgtacgtacaacacagaagacagg
gagctggccaccgtggggggcttcggtatcctggaggagatgtgcgtcaactacatccac
tactacccccagacgcagctggagctctgcaagagcaccgtggacccgggtttcctgcgg
gagtatttccacctggtgaacaggtga

DBGET integrated database retrieval system