KEGG   Panthera tigris altaica (Amur tiger): 102961644Help
Entry
102961644         CDS       T02988                                 

Gene name
MAPKAPK2
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04218  Cellular senescence
ptg04370  VEGF signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04722  Neurotrophin signaling pathway
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102961644 (MAPKAPK2)
   04370 VEGF signaling pathway
    102961644 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102961644 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102961644 (MAPKAPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102961644 (MAPKAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102961644 (MAPKAPK2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102961644 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102961644 (MAPKAPK2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102961644 (MAPKAPK2)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   102961644 (MAPKAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 102961644
NCBI-ProteinID: XP_015399333
Position
Un
AA seq 307 aa AA seqDB search
MLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRLQDR
GVPPLTATEASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKE
TTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISP
GMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQ
TPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARAL
EAAALAH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaggactgccccaaggcccgccgggaggtcgagctgcactggagggcttcccag
tgcccacacatcgtgcggatcgtcgatgtctatgagaacctgtacgcggggaggaagtgc
ctgctcattgtcatggaatgtctggatggcggagagctctttagccgactccaggaccgg
ggggtcccacctctcacggctacagaagcgtcagaaatcatgaagagcatcggtgaggcc
atccagtatctgcactcaatcaacattgcccatcgggatgtcaagcctgagaatctccta
tacacctccaaaaggcccaatgccattctgaaactcaccgattttggctttgccaaggaa
accaccagccacaattctttgaccactccttgttatacgccgtactatgtggctccggaa
gtgctgggtccagagaagtatgacaagtcctgtgacatgtggtccttgggtgtcatcatg
tacatcctgctgtgtgggtatccccccttctactccaaccatggtcttgccatctctccg
ggcatgaagactcgcatccgaatgggccagtatgaatttcccaacccagaatggtccgaa
gtgtcagaggaagtgaagatgcttatccggaacctgctgaaaacagagcccacgcagagg
atgaccatcacggagtttatgaaccacccctggatcatgcaatccacaaaggtccctcag
accccactgcacaccagccgggtcctgaaggaggacaaggagcggtgggaggatgtcaag
gaggagatgaccagtgccttggccacaatgcgcgtcgactacgagcagatcaagataaaa
aagattgaagatgcatccaatcctctccttctgaagaggcggaagaaagctcgggccctg
gaggccgcggccctcgctcactga

DBGET integrated database retrieval system