KEGG   Panthera tigris altaica (Amur tiger): 102961928
Entry
102961928         CDS       T02988                                 

Gene name
SIM1
Definition
(RefSeq) single-minded family bHLH transcription factor 1
  KO
K09100  single-minded
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102961928 (SIM1)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102961928 (SIM1)
SSDB
Motif
Pfam: SIM_C PAS_3 PAS_11 PAS HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 102961928
NCBI-ProteinID: XP_007097432
Position
Un
AA seq 766 aa
MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRVVFPEGL
GEAWGHSSRTSPLDNVGRELGSHLLQTLDGFIFVVAPDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPADHDEMTAVLTAHQPYHSHFVQEYEIERSFFLRMKCVLAKRNAGLTCGGY
KVIHCSGYLKIRQYSLDMSPFDGCYQNVGLVAVGHSLPPSAVTEIKLHSNMFMFRASLDM
KLIFLDSRVAELTGYEPQDLIEKTLYHHVHGCDTFHLRCAHHLLLVKGQVTTKYYRFLAK
HGGWVWVQSYATIVHNSRSSRPHCIVSVNYVLTDTEYKGLQLSLDQISASKPAFSYTSSS
TPTVTDNRKGVKSRLSGSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLL
DPGERPGSQHDASCAYRQFSDRSSLCYGFALDHSRLVEERHFHTQACEGGRCEAGRYFLG
TPQAGREPWWGSRAALPLTKSSPESREAYENSMPHIASVHRIHGRGHWDEDSVVSSPDPG
SASESGDRYRTEQYQSSPHEPSKIETLIRATQQMIKEEENRLQLRKAPPDQLASINGAGK
KHSLCFANYQQPPPTGEVCHGSALANTSPCDHVQQREGKMLSPHENDYDNSPTALSRISS
PNSDRISKSSLILAKDYLHSEMSPHQTAGDHPAVSPNCFGSHRQYFDKHAYTLTGYALEH
LYDTETIRNYSLGCNGSHFDVTSHLRMQPDPAQGHKGTSVIITNGS
NT seq 2301 nt   +upstreamnt  +downstreamnt
atgaaagagaagtccaaaaatgctgcccggactaggagggagaaggaaaacagtgaattt
tatgaactggcaaaattactgcctttgccctcggctatcacctcgcagctggacaaagca
tccataatcagactcacgaccagctatctcaaaatgagagtagtgttcccagaagggctc
ggcgaggcgtggggccactcgagtcgcaccagccccctggacaacgtaggcagagaactg
ggctcccatctgctccagaccctggatggcttcatctttgtggtggccccagatgggaag
atcatgtacatctcagagacagcctcagtccacctgggtctttctcaggtagagctgact
gggaacagcatttatgaatacatccacccagccgaccacgacgagatgaccgcggtgctt
acagctcatcagccctaccactctcacttcgtccaggaatacgagatcgagcgctccttc
ttcctcagaatgaagtgcgtcttggccaagaggaacgcgggcctcacctgcggtggctac
aaggtcattcactgcagcggctacctgaagatccgccaatacagcttggacatgtccccc
ttcgatggctgctaccagaacgtgggcctggtggctgtgggccactcgctgcctcccagt
gccgtcacggagatcaagctgcacagcaacatgttcatgttccgcgccagcctggacatg
aagctcatcttcctggactccagagtggcggagctgacggggtacgaacctcaggaccta
attgagaagacgttgtaccaccacgtgcacggctgtgacaccttccacctgcgctgcgcc
caccacctgctgctggtgaaggggcaggtgaccaccaagtactacaggttcctggcaaag
cacggtggctgggtatgggtgcagagctatgcgaccatcgtccacaacagccgctcgtcc
aggccacactgtatcgtcagcgtcaactatgtcctcacggacacggaatacaaaggtttg
cagctctccctggatcagatctcagcctctaaaccagccttctcctacaccagcagctcc
actcctaccgtgactgacaacaggaagggggtcaagtccaggctctccggctcaaagtca
aaatccaggacttccccatatcctcagtattcgggatttcacacggaaagatctgaatct
gatcacgacagccagtggggtggaagtcccctgacagacacagcctctccgcagctcctg
gaccccggggagaggccaggatctcagcatgacgcgtcgtgcgcctacagacaattctct
gaccgcagctctctctgctatggctttgcgctggaccattccaggctggtggaggagagg
catttccacacccaagcctgcgagggaggccggtgtgaggcaggcaggtacttcctggga
acgccgcaggccgggagggagccctggtggggctctcgtgcagccttgcccctgaccaag
tcctccccagaaagcagagaagcctatgaaaacagcatgcctcacatcgcttcagtgcac
aggatccacgggcgaggtcactgggatgaagatagtgtggtgagttctccagaccctgga
tctgccagcgaatcaggtgaccgataccgcactgagcagtatcaaagtagcccacatgaa
cctagcaaaattgaaactctgataagagccacccagcaaatgattaaagaagaagagaac
agattgcagctaaggaaagcccccccagaccaactggcctccattaatggagctgggaaa
aaacactccctctgttttgcaaactatcaacagcccccaccaacaggggaagtctgccac
ggctctgctcttgccaacacttcaccatgtgaccacgtccagcagagagagggaaagatg
ctgagcccccacgaaaatgactatgacaacagtcccactgcactgtctcgaataagtagt
cccaattcggatcgcatttcaaaatccagtttgatcctagctaaagactatctacattcg
gaaatgtctccacatcagaccgcgggagaccatcccgccgtctctccaaactgctttggt
tctcaccggcagtatttcgataagcatgcttacacattaactggatatgccctggagcac
ttatatgacactgaaaccattagaaactattccttgggctgtaatggctcacactttgat
gtaacttcccatctaaggatgcagccagacccagcacaaggacacaagggaacatctgtt
ataataaccaatggaagctga

DBGET integrated database retrieval system