KEGG   Panthera tigris altaica (Amur tiger): 102962224
Entry
102962224         CDS       T02988                                 

Gene name
NPAS3
Definition
(RefSeq) neuronal PAS domain protein 3
  KO
K09098  neuronal PAS domain-containing protein 1/3
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102962224 (NPAS3)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102962224 (NPAS3)
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS PAS_9 PAS_4
Other DBs
NCBI-GeneID: 102962224
NCBI-ProteinID: XP_015400150
Position
Un
AA seq 589 aa
MAIGLSGKPVKALFSLGGLKGEDPNLHESSSEDLLCESLDGFVFALNQEGKFLYISETVS
IYLGLSQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQS
ETPEPVESTSPSLLTTDNTLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLS
HGRTVPSQIMGLVVVAHALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPV
DIVGKRCYHFIHAEDVEGIRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAK
NANEKNIIWVNYLLSNPEYKDTPMDIAQLPHLPEKTSESSETSDSESDSKDTSGITEDNE
NSKSDEKGNQSENSEDPEPDRKKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFEN
PKAGEDGFGALGPMQIKVERYVESESDLRLQNCESLTSDSAKDSDSAGEAGAQASSKHQK
RKKRRKRQKGEVTLAMQGNLLPNAHAVNFVDVNSPGFGLDPKTPMEMLYHHVHRLNMSGP
FGGAVSAASLTQMPAGNVFTTAEGLFSTLPFPVYSNGIHAAQTLERKED
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggccattgggttgagtggaaaacctgtcaaggccctgttctccctgggaggcttaaag
ggggaggatcctaatcttcatgagtcatcctcagaagacctcttgtgtgagtccctggat
ggctttgtatttgcactaaatcaagaaggaaaatttttgtacatttctgaaaccgtctcc
atctacctaggcctctcacaagtggagctgacaggcagcagcgtctttgactatgtccac
ccgggggaccacgtggagatggcagagcagctgggcatgaagctcccccctgggcggggt
ctcctctcgcagggcaccgctgaggatggggccagctcagcatcttcctcctcccagtcg
gagacccctgagccagtggagtcaaccagccccagtctgctaaccactgacaacaccctt
gaacgttcctttttcatccgaatgaaatctactctgaccaaacgtggcgtgcacatcaaa
tcatcaggatataaggtgattcacataacaggccggctacgactgagggtgtcactatcc
cacgggaggaccgttcccagccaaatcatgggtcttgtggttgtggctcatgccctgcct
ccccctacgatcaatgaagtcagaattgactgccatatgttcgtcactcgagtaaatatg
gacctcaatatcatttactgtgaaaataggattagcgattatatggatctgacccctgta
gacattgtagggaagagatgctaccatttcatccatgccgaagacgtcgagggcatcagg
cacagtcacttggacctgctgaataagggccagtgtgtgacgaagtactatcgttggatg
cagaagaatggaggatatatttggatacagtctagtgccaccatagctattaatgccaag
aacgcaaatgagaagaatatcatctgggtgaattatcttcttagtaaccccgagtacaag
gacacacccatggatatcgcacagctcccccatctgccagagaaaacttcagaatcttcg
gagacatctgactctgaatcagactctaaagatacctcaggtattacagaggacaacgag
aactccaagtccgacgagaagggtaatcagtccgagaacagcgaagacccggaacccgac
cggaagaagtcgggcaacgcctgcgacaacgacatgaactgcaacgacgacggccacagc
tccagcaacccggacagccgcgacagcgacgacagcttcgagcactcggactttgagaac
cccaaggcgggcgaggacggcttcggcgcactgggccccatgcagatcaaggtggagcgc
tacgtggagagcgagtcggacctgcggctgcagaactgcgagtcgctcacgtcggacagc
gccaaggactcggacagcgccggcgaggcgggcgcgcaggcctccagcaagcaccagaag
cgcaagaagaggcggaaacggcagaagggcgaggtgaccctggccatgcagggcaacctg
ctgcccaacgcgcacgctgttaacttcgtggacgttaacagccccggcttcggcctcgac
cccaagacgcccatggagatgctctaccaccacgtgcaccggctcaacatgtcgggaccg
ttcggcggcgccgtgagcgccgccagcctgacgcagatgcccgccggcaacgtattcacc
acggccgagggactcttctccacgctgcccttccccgtctacagcaacggcatccacgcg
gcacagactctggagcgcaaggaggactga

DBGET integrated database retrieval system