KEGG   Panthera tigris altaica (Amur tiger): 102964622
Entry
102964622         CDS       T02988                                 

Gene name
ARNTL
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator like
  KO
K02296  aryl hydrocarbon receptor nuclear translocator-like protein 1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04710  Circadian rhythm
ptg04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    102964622 (ARNTL)
  09159 Environmental adaptation
   04710 Circadian rhythm
    102964622 (ARNTL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102964622 (ARNTL)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102964622 (ARNTL)
SSDB
Motif
Pfam: PAS_11 PAS PAS_3 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 102964622
NCBI-ProteinID: XP_007083294
Position
Un
AA seq 631 aa
MADQRMDISSTISDFMSPGTTDLLSSPLGPGGTDCNRKRKGSSTDYQESMDTDKDDPHGR
LEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKIL
NYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLC
SGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDE
DSEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAI
LAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRW
FSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEDSFVVGGPK
RTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSP
GGKKILNGGTPDIPSSGLLPGQAQENPGYPYSDSSSILGENPHIGIDMIENDQGSSSPSN
DEAAMAVIMSLLEADAGLGGPVDFSDLPWPL
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggccgaccagagaatggacatttcttcaacaatcagtgacttcatgtccccgggcacc
accgacctcctctccagccccctgggccccggcggcacggattgcaaccgcaagcggaaa
ggcagctccaccgactaccaagaaagcatggacacggacaaagatgaccctcacggaagg
ttagaatatacagagcaccaaggaaggatcaaaaatgcaagggaagctcacagccagatt
gaaaagaggcgtcgggacaaaatgaacagttttattgacgaattggcgtctttggtacct
acgtgcaatgccatgtccaggaaattagataagctcactgtgctaaggatggctgttcag
cacatgaaaacattacgaggtgccaccaatccatacacagaagcgaactacaaaccaact
tttctgtcagatgatgaattgaaacacctcattctcagggcagcagatggatttttgttt
gtcgtaggatgtgaccgagggaagatactctttgtctcagagtctgtcttcaagatcctc
aactacagccagaacgatctgattggccagagtttgtttgactacctgcaccctaaagat
atcgccaaagtgaaggagcagctctcctcctcggacacggcgccccgggagcggctcata
gatgcaaaaactggacttccagttaagacagatataacccctgggccgtctcgattatgt
tctggagcacgacgttctttcttctgtaggatgaagtgtaacaggccttcggtaaaggtt
gaagacaaggatttcccctctacctgctcaaagaaaaaagcagatcgaaagagcttctgc
accatccacagcacagggtatctgaagagctggccgcccacaaagatggggctggatgaa
gacagtgaaccagacaacgagggctgtaatctcagctgccttgtcgcaatcggacgacta
cattctcacgtggttccacagccggtgaacggggaaatcagggtgaagtctatggaatat
gtgtctcggcacgcgatagacgggaagtttgtttttgtagaccagagggcaacagctatt
ttggcatatttaccgcaagaacttctaggcacatcatgttatgaatattttcaccaagat
gacataggacatctcgcagaatgtcataggcaagttttacagacaagagaaaagattacg
actaattgctataagtttaaaatcaaagatggttctttcatcacgctgcggagtcgatgg
ttcagtttcatgaacccttggaccaaggaagtagaatacatcgtctcaaccaacactgtt
gttttagccaacgtcctggaaggcggggacccaaccttcccgcagctcacagcgtccccc
cacagcatggacagcatgctgccctctggagaagattcctttgttgtaggtggcccaaag
aggacccaccccactgttccagggattccagggggaaccagggctggggcaggcaaaata
ggtcgaatgattgctgaagaaatcatggagatccacagaataagagggtcatcgccttcc
agttgtggctccagcccattaaatatcacaagtacacctccccctgatgcctcttctcca
ggaggcaaaaagattttaaatggagggactccagacattccttccagtggcctactacca
gggcaggctcaggaaaacccaggttatccatattctgatagttcttctattcttggtgag
aaccctcacataggcatagacatgatagaaaacgaccaaggctcaagcagtcccagcaat
gatgaagcagcaatggccgtcataatgagtctcttggaagcagatgctgggctgggaggt
cctgttgacttcagtgacttgccatggccgctgtaa

DBGET integrated database retrieval system