KEGG   Panthera tigris altaica (Amur tiger): 102964767
Entry
102964767         CDS       T02988                                 

Gene name
ARNTL2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator like 2
  KO
K09099  aryl hydrocarbon receptor nuclear translocator-like protein 2
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102964767 (ARNTL2)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102964767 (ARNTL2)
SSDB
Motif
Pfam: PAS_11 PAS_3 PAS HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 102964767
NCBI-ProteinID: XP_007075697
Position
Un
AA seq 608 aa
MMLTVGLPYEAFIMLRMLIEKNECIAPMVSSYVSPWTKPTAIGSLSPHVTELPRKRKGSD
SDPSQKEDGEQHVQMKSFREAHSQTEKRRRDKMNNLIEELSTMIPQCNPVARRLDKLTVL
RMAVQHVRSLKGMTNSYAGGNYRPSFIQDNQLRHLILKTAEGFLFVVGCERGKILFVSKS
VSKTLNYDQASLTGQSLFDFLHPKDVAKVKEQLSSDISPREKLIDAKTDLQVHSNFHSGR
SHVYSGLRRSFFCRIRRCKISVKEEHECLSTSKKKDHRKFCTIHCTGYLRSWPPNIVGME
EEKDSKKDSSNFTCLVAIGRLHPYIVPQNSGEIKVKPTEFITRFAMNGKFVYVDQRATAI
LGYLPQELLGTSCYEYFHQDDHSNLTDKHKAVLQSKEKIFTDSYKFRKKDGSFVTLKSQW
FSFTNPWTKELEYIVSVNNLVLGHSEVREASLLPCSSQLSEESSKPSYINVPGMSTGIVL
GPGSIGTDLVNEALDLQRLQSSSSLEDSRPADLMKDSHTINYRKVSTMSNKEPIPRNPSE
IGEPEAPRQNHSAVPSHSHEPLLGQGAQLDFDALCDNDDTAMAAFMNYFEAEGGLGDPGD
ISDIHWTL
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgatgttaactgtgggcttgccatatgaggcctttattatgttgagaatgctgatagaa
aagaacgagtgcattgctcccatggtttccagttatgtaagcccatggacaaaaccaaca
gctatcggatccctcagcccacatgtgacagagctcccaagaaaacgaaaaggaagtgat
tcagacccatcccaaaaggaagatggtgaacaacacgtacaaatgaagtccttcagagaa
gctcatagtcaaactgaaaagcggaggagagataaaatgaataacctgattgaagaactg
tctacaatgatccctcagtgcaatcccgtggcacgtagactggacaaattgacggtttta
agaatggctgtccaacacgtgagatctttaaaaggtatgactaattcttatgcaggaggt
aattatagaccttcatttattcaggataatcagctcagacacttaatccttaagactgca
gaaggcttcctatttgtggttggatgtgaaagaggaaaaattctcttcgtttcgaaatca
gtctccaaaacacttaattatgatcaggctagcttgactggacaaagcttatttgacttc
ttacatccaaaagatgttgccaaagtaaaggagcaactttcttctgatatttcaccaagg
gagaagctgatcgatgccaaaactgatttgcaagttcatagtaatttccacagtggaagg
agtcacgtgtattctggcttgagacgatcctttttttgtcggataaggcgttgtaaaatc
tctgtcaaagaagagcatgaatgcttatccacctcaaagaaaaaagatcatagaaaattc
tgtactatccattgcactggttacttgagaagctggcctccaaatattgttggaatggaa
gaagaaaaggacagtaagaaagacagtagtaattttacctgccttgttgccattggaagg
ttacatccatatattgtaccacagaacagtggagagattaaagtgaaaccaactgaattt
ataacccggtttgcaatgaacgggaagtttgtctatgtggaccaaagggcaacagcaatt
ttaggatacctgcctcaggaacttttgggaacttcttgttatgaatattttcatcaggat
gaccatagtaatttgactgacaagcacaaagcagttctacagagtaaagagaaaatcttt
acagattcatacaagttcagaaagaaagatggctcttttgtaactttaaaaagccagtgg
tttagtttcacaaatccttggaccaaagaactggaatatattgtgtctgtcaacaattta
gttttgggacatagtgaggttagagaagcatcgttacttccttgcagctctcaattatca
gaagaatcctcaaaaccatcttatattaatgtacctggaatgtctactggaatagtactt
ggccctggtagtattggaacagatcttgtaaatgaagccctggacttacaaaggttacag
tcttcttcctcccttgaggactcaaggccagcagatttaatgaaagattctcacactata
aactacaggaaagtaagtacgatgtcaaataaggagccgattccacgaaatccttctgaa
ataggggagccagaggctccaaggcaaaaccacagtgctgttccttcccatagtcacgag
ccactccttggccaaggtgcccagctggattttgatgccctgtgtgacaatgacgacaca
gccatggctgccttcatgaattactttgaagcagaagggggcctgggagatcctggggac
atcagtgatatccactggacactctag

DBGET integrated database retrieval system