KEGG   Panthera tigris altaica (Amur tiger): 102965046
Entry
102965046         CDS       T02988                                 

Gene name
SIM2
Definition
(RefSeq) single-minded family bHLH transcription factor 2
  KO
K09100  single-minded
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102965046 (SIM2)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102965046 (SIM2)
SSDB
Motif
Pfam: SIM_C PAS_3 PAS_11 PAS HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 102965046
NCBI-ProteinID: XP_007099314
Position
Un
AA seq 563 aa
MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRAVFPEGL
GDAWGQPSRTGPLDSVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPSDHDEMTAVLAAHQPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSGY
KVIHCSGYLKIRQYMLDVSLYDSCYQIVGLVAVGQSLPPSAITEIKLHSNMFMFRASLDL
KLIFLDSRVTELTGYEPQDLIEKTLYHHVHGCDVFHLRYAHHLLLVKGQVTTKYYRLLSK
LGGWVWVQSYATVVHNSRSSRPHCIVSVNYVLTDIEYKELQLSLDQVSTSKSQDSWRTAL
STSQETRKLAKPKNTKMKTKLRTNPYPPQQYSSFQMDKLEGGQLGNWRASPPANAPAPPE
QQLHSESSDLLYAPSYSLPFSYHYGHFPLDSHVFSSKKSMLPAKFGQPRGSPCEVARFFL
SALPAGGECQWHYANPLVPSGQSPAKNLSEPPVNAARHSLVPNYEGGSCLHEGRGQDCER
CGGWQAEKGSSRFGQTSPFSACK
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgaaggagaagtccaagaatgcggccaagaccaggagggagaaggaaaatggcgagttt
tatgagctggccaagctgctcccgctgccgtcggccatcacctcgcagctggacaaggcg
tctatcatccgactcaccaccagctacctgaagatgcgggccgtcttccccgaaggttta
ggagatgcatggggacagccgagccgcaccgggcccctagacagcgtcgccaaggagctg
ggatcacacttacttcagactttggacggatttgttttcgtggtagcatctgatggcaaa
atcatgtatatatcggaaacagcttctgtacatttaggcttgtcacaggtggagctcaca
ggcaacagtatttacgagtacatccatccttccgaccacgacgagatgacagctgtcctc
gcggcccaccagcccctccaccatcacctgctacaagagtacgagatagaaaggtccttc
tttctgcgaatgaagtgtgttttggcgaaaagaaacgcgggcctgacgtgcagcggatac
aaggtcatccactgcagcggctacctgaagatcaggcagtatatgctggacgtgtccctg
tacgactcgtgctaccagatcgtggggctggtggccgtgggccagtcgctgccacccagt
gccatcacagagatcaagctgcacagtaacatgttcatgttcagggccagccttgacctg
aagctgatcttcctggattccagggtgaccgagctgaccgggtatgagccgcaggacctg
atcgagaagaccctctaccatcacgtgcacggctgtgacgtgttccacctccgctacgcg
caccacctcctgctggtgaagggccaggtcaccaccaagtactatcggctgctgtccaag
ctgggcggctgggtgtgggtgcagagttacgccaccgtcgtgcacaacagccgctcgtcc
cggccgcactgcatcgtgagtgtcaattatgtcctcacggatattgaatacaaggaactg
cagctgtccctggaccaggtgtccacatccaagtcccaggactcctggaggaccgccttg
tctacctcacaagaaactaggaaattagcgaaacccaaaaatacaaagatgaagacgaag
ctgagaacaaacccgtacccgccacagcaatacagctcgttccaaatggacaaactggaa
ggcggccagctgggaaactggagagccagccccccagcgaacgccccggcgcccccagaa
cagcagctccattcagaaagcagcgaccttttgtacgccccgtcctacagcctgcctttc
tcctaccattatggacacttccctctggactctcacgtcttcagcagcaaaaagtcaatg
ttgccggccaagttcgggcagccccgaggatccccgtgcgaggtggcacgctttttcctg
agcgcactgccagccggtggcgaatgccagtggcattatgccaaccccctagtgcctagc
ggccagtctccagccaaaaacctttctgagccgccggtgaacgctgctcggcacagcctc
gtgccaaactacgaaggtgggtcatgtttgcacgaggggagggggcaggactgcgaacgg
tgcggtgggtggcaagcggaaaaaggatcctcacgctttgggcaaacttctcctttttct
gcttgtaagtag

DBGET integrated database retrieval system