KEGG   Panthera tigris altaica (Amur tiger): 102965866
Entry
102965866         CDS       T02988                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00230  Purine metabolism
ptg01100  Metabolic pathways
ptg01522  Endocrine resistance
ptg04015  Rap1 signaling pathway
ptg04020  Calcium signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04024  cAMP signaling pathway
ptg04062  Chemokine signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04114  Oocyte meiosis
ptg04211  Longevity regulating pathway
ptg04213  Longevity regulating pathway - multiple species
ptg04261  Adrenergic signaling in cardiomyocytes
ptg04270  Vascular smooth muscle contraction
ptg04371  Apelin signaling pathway
ptg04540  Gap junction
ptg04611  Platelet activation
ptg04713  Circadian entrainment
ptg04714  Thermogenesis
ptg04723  Retrograde endocannabinoid signaling
ptg04724  Glutamatergic synapse
ptg04725  Cholinergic synapse
ptg04727  GABAergic synapse
ptg04742  Taste transduction
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04911  Insulin secretion
ptg04912  GnRH signaling pathway
ptg04913  Ovarian steroidogenesis
ptg04914  Progesterone-mediated oocyte maturation
ptg04915  Estrogen signaling pathway
ptg04916  Melanogenesis
ptg04918  Thyroid hormone synthesis
ptg04921  Oxytocin signaling pathway
ptg04923  Regulation of lipolysis in adipocytes
ptg04925  Aldosterone synthesis and secretion
ptg04926  Relaxin signaling pathway
ptg04927  Cortisol synthesis and secretion
ptg04928  Parathyroid hormone synthesis, secretion and action
ptg04934  Cushing syndrome
ptg04935  Growth hormone synthesis, secretion and action
ptg04970  Salivary secretion
ptg04971  Gastric acid secretion
ptg04972  Pancreatic secretion
ptg04976  Bile secretion
ptg05032  Morphine addiction
ptg05163  Human cytomegalovirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05200  Pathways in cancer
ptg05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102965866 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102965866 (ADCY4)
   04371 Apelin signaling pathway
    102965866 (ADCY4)
   04020 Calcium signaling pathway
    102965866 (ADCY4)
   04072 Phospholipase D signaling pathway
    102965866 (ADCY4)
   04024 cAMP signaling pathway
    102965866 (ADCY4)
   04022 cGMP-PKG signaling pathway
    102965866 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102965866 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102965866 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102965866 (ADCY4)
   04062 Chemokine signaling pathway
    102965866 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    102965866 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    102965866 (ADCY4)
   04912 GnRH signaling pathway
    102965866 (ADCY4)
   04913 Ovarian steroidogenesis
    102965866 (ADCY4)
   04915 Estrogen signaling pathway
    102965866 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    102965866 (ADCY4)
   04921 Oxytocin signaling pathway
    102965866 (ADCY4)
   04926 Relaxin signaling pathway
    102965866 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    102965866 (ADCY4)
   04918 Thyroid hormone synthesis
    102965866 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    102965866 (ADCY4)
   04916 Melanogenesis
    102965866 (ADCY4)
   04925 Aldosterone synthesis and secretion
    102965866 (ADCY4)
   04927 Cortisol synthesis and secretion
    102965866 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102965866 (ADCY4)
   04270 Vascular smooth muscle contraction
    102965866 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    102965866 (ADCY4)
   04971 Gastric acid secretion
    102965866 (ADCY4)
   04972 Pancreatic secretion
    102965866 (ADCY4)
   04976 Bile secretion
    102965866 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    102965866 (ADCY4)
   04727 GABAergic synapse
    102965866 (ADCY4)
   04725 Cholinergic synapse
    102965866 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    102965866 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    102965866 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    102965866 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    102965866 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    102965866 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102965866 (ADCY4)
   04714 Thermogenesis
    102965866 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102965866 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    102965866 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    102965866 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102965866 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102965866 (ADCY4)
   05163 Human cytomegalovirus infection
    102965866 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102965866 (ADCY4)
Enzymes [BR:ptg01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102965866 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 102965866
NCBI-ProteinID: XP_007098120
Position
Un
AA seq 1081 aa
MVQPDTNGKSRCPVSFCYLSLRHISEVAWGGCLFFFSLEAVPHTPHSSLAASTLSSQELA
SDPGFLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLIWAALLGLGHGFLFTGGLVSA
WDQVSFFLFVIFTVYAMLPLGMQDAAAAGLASSLSHLLVLGLYLGPQPDSKPALLPQLAA
NAVLFLCGNVAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLA
REMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVL
MLNELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLR
AATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLA
LLAGAYAVEDAAMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSL
LMTRYLESWGAAKPFAHLSHLESPVSTSTPLPEKALASFGPQWSLDRSRTPRGLDDDLDT
GDAKFFQVIEQLNSQKQWRQSKDFNPLTLYFRKKELEKEYRLSALPAFKYYAACTFLVFL
SNFIIQMLVTNRPPALAITYSITFLLFLLLLFVCFSEHLTRCVLKGPKMLHWLPALSGLV
ATRPGLRVALGTATILLVFVMAIPSLFFLPAASNCPFGALNVSSMAFNISWELPGSLPLI
SVPYSMHCCVLGFLSCSLFLHMSFELKLLLLLLWLGASCSLFLHSHAWLSDCLIARLYPD
PSDSRPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEQEETETMEN
LTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGL
ECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHL
GTMVEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVLGAQKPQYDIWGNTVNVASR
MESTGVLGKIQVTEETARVLQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLARTGPPSATL
G
NT seq 3246 nt   +upstreamnt  +downstreamnt
atggttcaacctgatacgaatggcaagtcgaggtgccctgtctccttttgctacttgagt
ttgagacacatttcagaagtggcctgggggggctgcctgttcttcttcagcttggaggcg
gtcccccatactccacactccagtcttgctgcaagcaccctctcctcgcaggagctagct
tcagacccaggcttcctgaccactgtgctgtgcgcgctgggtggcttctcgctgctcctg
ggcctggcttcccgggagcaacgactgcagcgctggacacgtcccctgtcgggcctcata
tgggcagcgctactcgggctaggccacggcttcctgttcactgggggcctggtgagcgcc
tgggaccaggtgtcctttttcctctttgtcatcttcaccgtgtacgccatgttgcccttg
ggcatgcaggatgccgctgctgcgggccttgcctcatcgctctcccacttgctggtcctg
gggctgtaccttgggcctcagccggactcaaagcctgcgctgctgccacagctggcagcg
aacgcggtgttgttcctgtgcgggaacgtggcgggagcgtatcacaaggcgctgatggag
cgcgcgctgcgcgccacattccgcgaggcacttagctccctgcactcgcgccggcggctg
gacaccgagaagaagcaccaggaacaccttctcttgtccatccttcctgcctacttggcc
cgagagatgaaggcagagatcatggcacgactgcaggctggacaggggtcacggccagaa
agcaccaacaacttccacagcctctatgtcaagaggcaccagggagtcagtgtgctgtat
gctgacatcgtgggcttcacccggctggccagtgagtgctctcctaaggagttggtgctc
atgctcaacgagctctttggcaagttcgaccagatcgccaaggagcatgaatgcatgcgg
atcaagatcctgggagactgttactactgtgtctctgggctaccgctctccctgccagac
cacgccatcaactgcgtgcgcatggggctggacatgtgccgggccatcaggaagctccgg
gcagccactggcgtggacatcaacatgcgtgtgggcgtgcattcgggcagtgtgctctgc
ggagtcattgggctgcagaagtggcagtatgatgtctggtcccatgatgtcacactggcc
aaccacatggaggcgggtggcgtgccaggacgagtacatattacaggggctaccctggcc
ctgctggcaggggcttatgctgtggaggatgcagccatggaacaccgggacccatacctt
cgggagctaggggagcctacctacctagtcatcgatccccgggctgaggaagaggatgag
aagggcactgcaggagggttgctgtcctctcttgagggccccaagatgcgtccgtcactg
ctgatgacccgctacctggagtcctggggcgccgccaagccttttgcccatctgagccac
ctagagagccctgtgtccacttctacccctctcccggagaaggccctggcttcctttggc
ccccagtggagcctggaccggagccgtaccccccgggggctagatgatgacctggacact
ggggacgccaagttcttccaggtcatcgaacagctcaactctcagaaacagtggaggcag
tcaaaggacttcaacccactgacactgtacttcagaaagaaggaactggagaaagagtac
cgactctctgcactccccgccttcaaatactacgcagcctgcaccttcctggttttcctt
tccaatttcatcatccagatgctggtgacaaacaggcccccagctcttgccatcacctat
agcatcaccttcctcctcttcctcctcctcctcttcgtctgcttctcagagcacctgacg
aggtgtgtcttgaaaggccccaagatgctgcactggctgccggcactgtctggcttggtg
gccacacggcccggactgcgagttgcccttggcacagctaccatcctcctggtttttgtg
atggccattcccagcctgttcttcttaccagcagcatcaaactgcccttttggggctctc
aatgtgtcctccatggctttcaacatctcctgggagctccctgggtccctgcctctcatc
agcgtcccctactctatgcactgctgcgtgctggggttcctgtcctgctccctctttttg
cacatgagcttcgagctgaagttgctgctgctcctgctatggctgggggcctcctgctcc
ctcttcctgcactcccatgcctggctgtccgactgcctcatcgcccgcctctatccggat
ccctcggactccaggccaggggtgctgaaggagcccaaactgatgggagctatctccttc
ttcatcttcttcttcaccctccttgtcctggctcggcagaatgagtattactgccggctg
gacttcctgtggaagaagaagctgcggcaggagcaggaggagacagagaccatggagaac
ctgactcggctgctgttggagaatgtgctccctgcacatgtggccccccagttcattggc
cagaaccggcgcaacgaggacctctaccaccagtcctatgagtgtgtctgtgtcctgttc
gcctcagttccagacttcaaggagttttactctgagtccaacataaaccacgagggtcta
gagtgtctgcggctgctcaatgagataattgctgattttgatgagctgctctcaaagccc
aagtttagtggggtggagaagatcaaaaccatcggtagcacctacatggcagctacaggc
ttaaatgccacctccggacaggacgcacagcaggatgctgagcgcagctgcagccacctt
ggcaccatggtggagtttgcggtggctcttggatcaaagctggacgtcatcaataagcac
tctttcaacaacttccgcttgcgtgtggggttgaaccacggacctgtagtggctggggtg
ctcggggcccagaagccgcagtatgacatctggggcaacacagtgaacgtggccagccgc
atggagagtacaggagtcctgggcaagatccaggtgactgaagagacggcccgggtgctg
cagtccttaggctacacctgctacagccggggtatcatcaaggtcaaaggcaaagggcaa
ctctgcacctactttctgaacacagatttggcacgaactggacctccctcggccacccta
ggctga

DBGET integrated database retrieval system