KEGG   Panthera tigris altaica (Amur tiger): 102966267
Entry
102966267         CDS       T02988                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04080  Neuroactive ligand-receptor interaction
ptg04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102966267 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102966267 (APLN)
SSDB
Motif
Pfam: Apelin OppC_N
Other DBs
NCBI-GeneID: 102966267
NCBI-ProteinID: XP_007085522
Position
Un
AA seq 76 aa
MLNKFQYISIIIITIIIVVVIWPLLQPSDGNGLEEGNVRHLVQPRGSRNGPGPWQGGRRK
FRRQRPRLSHKGPMPF
NT seq 231 nt   +upstreamnt  +downstreamnt
atgctcaataaatttcagtatatcagcatcatcatcatcaccatcatcatcgtcgtcgtc
atctggcccctgctgcagccttctgatgggaatgggctggaggaaggcaatgtccgccac
ctggtacagcccagagggtcgaggaacggaccagggccatggcagggaggtcggaggaaa
ttccgccgccagcggccgcgcctctcccacaagggccccatgcctttctga

DBGET integrated database retrieval system