KEGG   Panthera tigris altaica (Amur tiger): 102966914Help
Entry
102966914         CDS       T02988                                 

Gene name
A4GALT
Definition
(RefSeq) alpha 1,4-galactosyltransferase
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00601  Glycosphingolipid biosynthesis - lacto and neolacto series
ptg00603  Glycosphingolipid biosynthesis - globo and isoglobo series
ptg01100  Metabolic pathways
Module
ptg_M00068  Glycosphingolipid biosynthesis, globo-series, LacCer => Gb4Cer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    102966914 (A4GALT)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    102966914 (A4GALT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ptg01003]
    102966914 (A4GALT)
Enzymes [BR:ptg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     102966914 (A4GALT)
Glycosyltransferases [BR:ptg01003]
 Glycan extension
  P blood group
   102966914 (A4GALT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug
Motif
Other DBs
NCBI-GeneID: 102966914
NCBI-ProteinID: XP_007079539
Position
Un
AA seq 418 aa AA seqDB search
MPPGHVRDACLLTAWPEERVVEVLDFCQSDRWICGRGELVEGPCSCWQRRPASSRWRLLV
SSGENMSRPPDCLLRLLRGAPRQRVCTLFIIGFKFTFFVSVMIYWHIAGEPGGQREFSNL
PADVPCPRLVPPTPISSTPPPGNIFFLETSDRTSPNFLFMCSVESAARAHPESRVVVLMK
GLPGGNASLPRHLGLSLLGCFPNVHVLPLDLEGLFRDTPLAAWYAARRRRWEPYLLPVLS
DASRIALMWKFGGIYLDTDFIVLKSLRNLTNTLGTQSRYVLNGAFLAFERHHEFMALCMR
DFVAHYNGWIWGHQGPQLLTRVFKKWCSVRSLGDSHACRGVTALPCEAFYPIPWQHWKKY
FEDISPQELRRLLNATYAVHVWNRKSQGTRFKATSRALLAQLHARYCPTTHEAMKMYL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccggccatgtgcgagatgcctgtttgctcacagcctggccagaagaacgggtt
gtcgaagttttggatttttgccaatctgacagatggatttgtggacgcggagagcttgtg
gaagggccgtgttcctgttggcagagaagaccagccagttcccgctggaggctcctggtg
tcatctggggagaacatgtccaggccccctgactgcctgctgcggctgctccggggagcc
ccgaggcagcgggtctgcaccctgtttatcatcggcttcaagttcacgtttttcgtctcc
gtcatgatctactggcacatcgcgggagagcccggcggccagagggagttctctaacctg
cctgccgacgtcccctgcccccggctggtgccccctacgccgatctccagcaccccgcct
ccgggcaacatcttcttcctggagacctcagaccggaccagccccaacttcctattcatg
tgctccgtggagtcggcggccagggctcaccccgagtcccgggtggtggtcctgatgaag
gggctgcccggcgggaacgcctccctgccccggcacctggggctctcgcttctgggctgc
ttccccaacgtccacgtgctcccgctggacctggaagggctgttccgggacacgccgctg
gcggcctggtacgcggccaggcgacgccggtgggagccttacctgctgcccgtgctctcc
gacgcctccaggatcgcgctcatgtggaagttcgggggcatctacctggacacggacttc
atcgtcctcaagagcctgcggaatctgaccaacacgctgggcactcagtcccgctacgtc
ctcaacggggccttcctggccttcgagcgccaccacgagttcatggcgctgtgcatgcga
gacttcgtggcccactacaacggctggatctggggccaccagggcccgcagctgctcacg
cgggtcttcaagaagtggtgctccgtccgcagcctgggtgacagccacgcctgccgcggg
gtcaccgccctgccctgtgaggccttctaccccatcccctggcagcactggaagaagtac
ttcgaggacatcagcccccaggagctgcgccggctgctcaacgccacctacgccgtccac
gtgtggaacaggaagagccagggcacccgcttcaaggccacgtccagggcactgctggcc
cagctccacgctcgctactgccccacgacacacgaggccatgaagatgtacttgtga

DBGET integrated database retrieval system