KEGG   Panthera tigris altaica (Amur tiger): 102967365
Entry
102967365         CDS       T02988                                 

Definition
(RefSeq) aryl hydrocarbon receptor-like
  KO
K09093  aryl hydrocarbon receptor
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04659  Th17 cell differentiation
ptg04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102967365
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102967365
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102967365
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102967365
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 102967365
NCBI-ProteinID: XP_007075778
Position
Un
AA seq 990 aa
MASLSPPSPKPQPPEGAKSNPSKRHRDRLNQELTKLTNLLPFPEDVRARLDKLSILRLIV
GYLKVKSYFAAILKDSIADCSGDPPMNPGRSEHTSPQVNVELFSEGDLLLQALNGFLMAV
TEDGYVLYVSPTVQDYLGFHQSDVIYQSVFELIHKEDRAMFQSQFLWPPDAAPISREGEQ
DNHPLPGENCLSLNGTPTDSLQHQPLEDPSYLERSFVCRFRCLLDNSSGFLELNFHGHLK
LLPGQNNRSEDGILMSPQLTLFAIATPRQPLTILELQNKTFLFQTKHKLDFTPIACDSRG
KVVLGYTDSELCRKGSGYQFIHAADMMHCAENHVRMMRTGESGLTVFRLLTKQAGWLWVQ
SNARLVFRGGQPDCIVARQRALTNAEGEDHLRKRALQLPFTFTTGEAILYDSSPLSPLTS
LPARKRIRARKGTPTGQGPVHPGSLLGAMMRQDESMYLSCMVPTTQGSPLERQGSNGRHE
DKEEKEKEEDHSFLSLIETLLEKDTEEQPDLCSTLQHLGVTDLKQCLWEESLLRADSGPA
GSQNFHPLPSSQGGGSHREKEVLFHDSGNVALPPPASTTVPQTLKPQPSLGSGQLTGEVT
PPQNMGTVPSCLHTHTQHFFTTGPTFQSPPQWQPQHTQAEPLNFGICQKPTIFDFSPLPE
ASSPRQPAQVFQPNHTSLLPLGENVVPGHLDQPDPGFLDFCKEPMLWTASHSGQCQGPFI
SSDPTSWGTHPSESIWDSPIQGQPVMVPVEVEARQAQPDPFYHLRSTMANSCPPWAGPAS
DIPPELCCGLPPSVQGALGTPKDTLGSQEHPPHSLVVSQLSGSPACPSQELLNRPLAMQD
SCSMDCPCPAAKQQQWLQTQEAYGPVRERFPSVQHLGGCSRDAIPPTLQLSPFLSSKSSS
PGIGSSQCKSPAEPTRRSKDRPVILAPGAVVKSQVQSSPVLPPCHPDPACPSTSTQGSHD
LQLQCYQNKVHSTRAPGIASLKGSTFSSKF
NT seq 2973 nt   +upstreamnt  +downstreamnt
atggcttctctctcccccccaagtcctaaaccacagcctccagaaggagccaagtccaac
ccttctaaacggcaccgggaccgcctgaatcaagagctgaccaaactgaccaacttgctg
cccttccctgaggatgtgcgagcccggcttgacaagctctccatcctcaggctgattgtg
ggctacctaaaggtgaagagctactttgcagccatcctaaaggacagcattgcagactgc
tcaggtgacccacccatgaatccaggaagaagtgagcatacctctccacaggtcaatgta
gaactgttttctgaaggggacttgcttcttcaggccctcaacggcttcctcatggcagtt
acagaggatggctatgttttatacgtctctcccacggtccaggactacttgggatttcat
caatcagatgtcatctatcagagtgtgttcgagctgatccacaaggaggatagagccatg
ttccagagccaatttctctggcctccagatgcagcacctatcagcagagagggagagcag
gacaaccaccctctgcctggagagaactgtctctcacttaatggcacccccactgacagc
ctgcagcatcagcccttggaggacccctcctatctggaaagaagttttgtctgtcggttc
cgctgcctgctggacaactcttctgggtttctggagctgaatttccatggccatcttaaa
ctcctccctgggcagaacaacagatcagaagatggcatcctcatgtctcctcaactcacc
ctgtttgccattgcaacacctcgccagccactcaccatcctggagctccaaaacaaaaca
tttcttttccaaacaaaacacaaattggatttcacacctatagcctgtgattccagaggc
aaggtggtcctgggttacaccgacagcgaactctgcaggaaaggatcgggctaccagttc
atccacgcggccgacatgatgcactgcgccgagaatcacgtgcggatgatgaggacgggc
gagagcggcctcacggtgttccggctgctcaccaagcaggccggctggctgtgggtgcag
tccaacgcccgcctggtgttccgtggcggccagcccgactgcatcgtcgcccggcagcgg
gccctgacgaatgcagagggggaagatcacctgcgcaagagggccctgcaactgccgttc
accttcaccacaggggaagccatcctgtatgatagcagccccctgagccctctgacttcc
ctcccagccaggaagaggatccgggcaaggaagggcacccccactggtcagggccctgtg
cacccaggctctcttctgggagccatgatgcggcaagatgaatccatgtatttgtcctgc
atggtcccaaccacccaaggctcacccttggagaggcaggggtccaatggcagacatgag
gacaaggaagagaaagagaaggaggaagaccactccttcctgtccctcattgagaccctg
ctggagaaggacacagaagaacagcctgatctctgctccactctccagcacctgggggtc
actgacctcaagcagtgtttgtgggaagagagccttctcagggctgactcaggccctgca
gggtctcagaacttccacccactgccctccagtcagggagggggctcccacagggaaaag
gaagtactttttcatgacagtggaaatgtggcattgcccccaccagccagcacaactgtt
ccacagaccctaaagccacagccttctctgggctcgggccagctaactggggaagtaact
ccacctcagaacatgggcacagtgcccagctgccttcacacacacacccagcattttttc
accactggccctacattccagagccctccacagtggcagcctcagcacacccaggcagaa
cctttaaattttgggatatgccagaaaccaacaatatttgacttcagccccctccccgag
gcctccagccccagacagcctgctcaggtgtttcagccaaaccacacatctttgctccct
ttaggagaaaatgttgtccctggacacctggatcagccagaccctggttttcttgatttt
tgcaaagaacctatgctctggacagcctcacacagtggtcagtgtcaagggcccttcatc
tcctcagaccctacctcctggggcacccatccctcggagagcatttgggattcccccatc
caaggccagccagtaatggtccctgtggaagtggaggcaaggcaggcccagcctgacccc
ttctaccacctgaggtcaaccatggccaactcatgccctccatgggcagggccagccagt
gacattcctcctgaattgtgctgtggtttgcccccatctgtgcagggggcactaggtacc
ccaaaggacacacttgggagtcaagagcacccaccccactccttggtggtgagccagctc
tcggggagccctgcctgtccttcccaggagctcctgaacagacccttggctatgcaggac
tcttgcagcatggactgcccctgcccagctgccaagcagcagcagtggctgcagacccag
gaggcatacgggccagtgagagaaagatttccaagtgtccagcacctgggtggctgctca
agagatgccattccccccaccctgcagctgagccccttcctgtcctccaaaagcagctcc
ccaggtataggcagcagccaatgcaagagcccagctgaacccacaaggcggagcaaggac
agaccggtcatcctagccccaggtgctgtggtgaaatcccaggtgcagtccagccctgtt
ctgcctccctgccatcctgaccctgcctgcccatctacgtctacgcagggcagccatgac
ctccagctccagtgttatcaaaacaaagtgcacagcaccagagcacctgggattgcaagc
ctcaaaggaagcacgttttcctccaaattctga

DBGET integrated database retrieval system