KEGG   Panthera tigris altaica (Amur tiger): 102967445Help
Entry
102967445         CDS       T02988                                 

Gene name
GPX5
Definition
(RefSeq) epididymal secretory glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg00590  Arachidonic acid metabolism
ptg01100  Metabolic pathways
ptg04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102967445 (GPX5)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102967445 (GPX5)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102967445 (GPX5)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102967445 (GPX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 102967445
NCBI-ProteinID: XP_007092781
Position
Un
AA seq 221 aa AA seqDB search
MAQLPASSLFPLLLVGVTCMNPKPPEKVKMDCYKDVKGTIYEYDALTLNGKEHIQFKQYA
GKHVLFVNVATYCGLTAQYPELNALQDELKPWGLVVLGFPCNQFGNQEPGENSEILPGLK
YVRPGRGYVPNFQLFEKGDVNGKTEQKVFSFLKLSCPPTSDLLGSPDQLFWEPMKVHDIR
WNFEKFLVGPNGVPVMRWFHQAPISTVRADILEYLKQLKTK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttaccggcctcctccctcttccctcttctgctagtcggcgtcacgtgcatg
aatcccaagcccccagagaaggtgaagatggattgctacaaagatgtgaaaggcaccatc
tacgaatatgacgccctcactcttaatggaaaggaacacattcagttcaagcagtacgcg
ggcaagcacgtccttttcgtcaacgtggccacctactgcggtctgacggctcagtatcct
gaactgaacgcacttcaggacgagctgaagccctggggcctggtcgtgctgggctttccc
tgcaaccagtttgggaaccaggaaccaggagagaactcggagatccttccggggctgaag
tatgtgcgtccagggagaggatatgtaccgaatttccagctttttgagaaaggggatgtg
aatggcaaaacagaacagaaagtcttcagcttcttgaagctctcctgccctccgacctcg
gatcttttgggctcaccagaccagctgttctgggagcccatgaaggtccacgacatccgc
tggaactttgagaagttcctggtggggcccaacggggtccctgtcatgcgctggttccac
caggctcccatcagcaccgtcagagcggacatcctggagtacctgaagcagctaaaaacg
aaatag

DBGET integrated database retrieval system