KEGG   Panthera tigris altaica (Amur tiger): 102967666Help
Entry
102967666         CDS       T02988                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00561  Glycerolipid metabolism
ptg01100  Metabolic pathways
ptg04714  Thermogenesis
ptg04723  Retrograde endocannabinoid signaling
ptg04923  Regulation of lipolysis in adipocytes
Module
ptg_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102967666 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102967666 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    102967666 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    102967666 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ptg01002]
    102967666 (MGLL)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102967666 (MGLL)
Peptidases [BR:ptg01002]
 Serine Peptidases
  Family S33
   102967666 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Peptidase_S9 Abhydrolase_5 Thioesterase PGAP1 LIDHydrolase
Motif
Other DBs
NCBI-GeneID: 102967666
NCBI-ProteinID: XP_007097442
Position
Un
AA seq 346 aa AA seqDB search
MPPCDRRDEGTALICLALILHAVVVVECKSQDMMETGLGDPFRMPEESSPRQTPQSVPYQ
DLPHLVNADGQYLFCRYWKPTGTPKALIFMSHGAGEHCGRYDELAQMLVGLELLVFAHDH
VGHGQSEGERMVVSDFHVFIRDVLQHVDIMQKDYPGLPVFLLGHSMGGAITILTAAERPG
LFSGMVLISPLVLASPESATTFKVFAAKVLNLVLPNMSLGPIDSSMLSRNKTEVDIYNAD
PLICRAGLKVCFGNQLLNAVTRVERALPKLTLPFLLLQGSADRLCDSKGAYLVMESSKSQ
DKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTAAAGKQSPL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctgtgaccgccgagatgagggaacagcccttatttgcctggctctgattctc
catgctgtcgtggttgtggaatgcaaaagccaggacatgatggaaacaggacttggagat
cctttcagaatgccggaggaaagttctcccaggcagaccccacagagcgttccataccag
gacctgcctcacctggtcaatgccgatggacagtacctcttctgcaggtactggaaacct
acgggcacacccaaggccctcatctttatgtcccatggagccggggagcactgtggccgc
tatgacgagctggctcagatgctggtggggctcgagctgctggtgttcgcccacgaccat
gttggccatggacagagcgaaggggagaggatggtagtgtctgacttccacgttttcatc
agggatgtgctacagcacgtggatatcatgcagaaagactacccggggctccctgtgttc
ctgctgggccactccatgggaggtgccatcaccatccttacggccgcagagagaccgggc
ctcttctccggcatggtcctcatttcgcctttggttcttgccagtcctgagtctgcaaca
actttcaaggtctttgctgcgaaagttctcaaccttgtcctgccaaacatgtccctgggc
ccaatcgactccagcatgctctctcggaataagacggaggtcgacatttataatgcggac
cccctcatctgccgggcgggactgaaggtgtgcttcggcaaccagctgctcaatgccgtc
acgcgggtggaacgggccctccccaagctgaccttgcccttcctgctgctccagggctct
gctgaccgcctttgtgacagcaaaggggcctacctggtcatggagtcctccaagagccag
gacaaaacactcaagatttacgaaggtgcctaccacgttctccacaaagagcttccagaa
gtaaccaactccgtcttccacgaaataaacatgtgggtctcccaaaggacagcagccgcg
ggaaagcagtccccgctctga

DBGET integrated database retrieval system