KEGG   Panthera tigris altaica (Amur tiger): 102969285
Entry
102969285         CDS       T02988                                 

Gene name
ARNT
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04066  HIF-1 signaling pathway
ptg04934  Cushing syndrome
ptg05200  Pathways in cancer
ptg05204  Chemical carcinogenesis
ptg05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102969285 (ARNT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102969285 (ARNT)
   05204 Chemical carcinogenesis
    102969285 (ARNT)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    102969285 (ARNT)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102969285 (ARNT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102969285 (ARNT)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102969285 (ARNT)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PRAS
Other DBs
NCBI-GeneID: 102969285
NCBI-ProteinID: XP_007088143
Position
Un
AA seq 781 aa
MTSDVPSLGPAIASGNPGAGIQSGGAIVHRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSN
DKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKL
TILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYV
SDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQ
QSSMRMCMGSRRSFICRMRCGNSSVDPVSMNRLSFVRNRCRNGLGSVKDGEPHFVVVHCT
GYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPSCTDMSNVCQPTEFISRHNI
EGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRF
RSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTAN
LPLEMGSGQLASRQQQQQTELDVVSGRDGLAGYNHSQVSVQPVTTTGPEHSKPLEKSDSL
FAQDRDPRFSEIYSNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLASP
VTIVQPSASAGQMLAQISRHSNPPQGAAPTWTPSTRPGFSAQQVATQATAKTRSSQFGVG
SFQTPSSFSPMSLPGASTASPGAAAYPSLTNRGSNFAPETGQTTGQFQTRTAEGVSVWPQ
WRGPQPHHRSSSSEQHVQQPSAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPSFS
E
NT seq 2346 nt   +upstreamnt  +downstreamnt
atgacatcagatgtaccatcactgggtccagccattgcctcaggaaaccctggggctggg
attcaaagtggaggagccattgtccacagggctattaagcggcgaccagggttggatttt
gatgatgatggagaagggaacagtaaatttttgaggtgtgatgatgatcagatgtctaat
gataaggagcgatttgccaggtcggatgatgagcagagctctgcggataaagagagactc
gccagggagaatcacagtgaaattgaacggcggcgacggaacaagatgacagcctacatc
acagaactgtcagacatggtgcccacctgtagtgccctggctcgaaaaccagacaagcta
accatcttacgcatggcagtctctcacatgaagtccttgcgaggaactggaaatacatcc
actgatggcacctacaagccttcattcctcactgatcaggaactcaaacatttgatcttg
gaggcagcagatggctttctgttcattgtctcatgtgagacaggtcgggtggtttatgtc
tctgactcagtgacccctgttttgaaccagcctcagtctgaatggtttggtagcacactc
tatgatcaggtgcatccagatgacgtggacaaacttcgtgagcagctttccacttcagaa
aatgccctgacagggcgtatccttgatctgaagactggaacagtgaaaaaggaaggccag
cagtcttccatgaggatgtgtatgggctcaaggagatcatttatttgccgtatgaggtgt
ggcaatagctctgtagaccccgtctccatgaatagactgagctttgtgaggaacagatgc
aggaacggacttggctctgtgaaggatggggaacctcattttgtggtggtccactgcaca
ggctatatcaaggcctggcccccagcaggtgtctccctcccagatgatgatccagaggct
ggccaggggagcaaattttgcctagtggccattggcagactacaggtaaccagttctccc
agctgtacagacatgagtaacgtttgtcaaccaacagagttcatctctcggcacaacatt
gaggggatcttcacttttgtggatcaccgctgtgtggctactgttggctatcaaccacag
gaactcttaggaaagaatattgtggaattctgtcatcccgaagaccaacagcttctaaga
gacagcttccaacaggtggtgaagttaaaaggccaggtgctgtctgtcatgttccggttc
cggtctaagaaccgggaatggctctggatgagaaccagctcctttactttccagaaccct
tactcagatgaaattgagtacatcatctgtaccaacaccaatgtgaagaactccagccag
gaaccaaggcctacactgtccaacacaatccagagaccacagctaggtcccacagctaat
ttacccttggagatgggctcagggcagttggcatccaggcagcagcaacagcaaacagaa
ttggatgtggtatcaggaagagatggactggctggctacaatcattcccaggtttctgtt
cagcctgtaacaaccacagggccagaacacagtaagccccttgagaagtcagatagtctg
tttgcccaggatagagatccaagattttcagaaatctactctaacatcaatgcagatcag
agtaaaggcatctcctccagcactgtccctgctacccaacagctattctcacagggcaac
acattccctcctaccccccggccggcagagaatttcagaaatagtggtctggcctctcct
gtaaccatcgtccagccatcagcttctgcagggcagatgttggcccagatttcccgccac
tccaacccaccccaaggagcagccccaacttggacccctagcacccgcccaggcttctct
gcccagcaggtggctactcaggctacagccaagactcgttcttcccagtttggtgtgggc
agctttcagactccgtcctccttcagccccatgtccctccctggtgcttcaactgcgtca
cctggtgctgctgcctaccctagtctcaccaatcgtggatccaactttgctcctgagact
ggacagactacaggacaattccagacacggacagcagagggtgtaagtgtctggccacag
tggcggggcccccagcctcatcatcgctcgagttctagcgagcaacatgttcaacagcca
tcagcacagcaacctggccagcctgaggtcttccaggagatgctgtccatgctgggagac
cagagcaacagctacaacaacgaagaatttcctgacctaactatgtttccctccttttca
gaatag

DBGET integrated database retrieval system