KEGG   Panthera tigris altaica (Amur tiger): 102970573Help
Entry
102970573         CDS       T02988                                 

Gene name
MARS2
Definition
(RefSeq) methionyl-tRNA synthetase 2, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00450  Selenocompound metabolism
ptg00970  Aminoacyl-tRNA biosynthesis
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    102970573 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102970573 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ptg01007]
    102970573 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ptg03016]
    102970573 (MARS2)
Enzymes [BR:ptg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     102970573 (MARS2)
Amino acid related enzymes [BR:ptg01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   102970573 (MARS2)
Transfer RNA biogenesis [BR:ptg03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    102970573 (MARS2)
 Prokaryotic type
   Other AARSs
    102970573 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 DUF5600 D123
Motif
Other DBs
NCBI-GeneID: 102970573
NCBI-ProteinID: XP_015398696
Position
Un
AA seq 599 aa AA seqDB search
MVQFSALRLLRXXXXXXXQGRPGRRGPPLRVFSPPRHYSSAPLRARDDARDARAFFTTPI
FYVNAAPHIGHLYSALLADALCRHRRLRVPSAAATRFSTGTDEHGLKIQQAAAAAGLAPT
ELCDRVSAQFQQLFREAGISSTDFIRTTEVRHRIAVQHFWGLLKARGLLYKGLYEGWYCA
SEECFLPEAKVTRQPSSSGNSCPVSLESGHPVVWTKEENYIFRLSQFREPLQQWLRGDPQ
AITPEPFHHAVLQWLKEGLPDLSVSRRSSHLHWVPGDDSQTIYVWLDALVNYLTVIGYPN
AEFKSWWPTTSHIIGKDILKFHAIYWPALLLGAGMSPPHRIYVHSHWTVCGQKMSKSLGN
VVDPRTCLDRYTVDGFRYFLLRQGVPNWDCDYYDEKVVKLLDSELADALGGLLNRCTANR
INPSGTYPVFCTTCFPSEPGLVGPSVRAQAEDYALVNAVATLPKQVADHYDNFQIYKALE
AVSSCVRQTNGFVQRHAPWKLNWESPVDAPWLGTVLHVALECLRVFGTLLQPVTPSLADK
LLSRLGVSATERGLGELCFLPRFYGHPCPFEGRRLGPETGLLFPRLDQSRAWLVKAHRT
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagttttctgccctgcggctgctaagacnnnnnnnnnnnnnnnnnnntcaaggg
cggccggggaggagaggacccccgctccgggtcttctcccccccccgccactacagttcg
gcccctctccgtgcccgcgacgatgctcgcgacgcgcgcgctttcttcacgacacccatt
ttctacgtgaacgcggcgccgcacatcgggcacctgtactcggcgctactggcagacgcc
ttgtgccgccaccgtcgcctccgagttcccagcgccgccgccacgcgattctccactggt
accgacgagcatggcctgaagattcagcaagcagcagccgctgcgggcctggccccgacc
gagctgtgcgaccgagtctctgcccagttccagcagctttttcgggaggctggcatctcc
tctaccgacttcatccgcaccaccgaagtccggcaccggatcgctgtgcagcatttctgg
ggattgctgaaggcgcggggtctgctctacaagggtctctatgaaggttggtattgcgcc
tccgaagagtgcttcctgcctgaggccaaggtcaccaggcagccgagttcctcggggaat
tcgtgtcctgtgtctttagagagtgggcatcccgtagtctggaccaaggaagaaaactac
attttcaggctttctcagttccgagagcctcttcagcagtggctgcggggcgaccctcag
gcaatcacccctgagccatttcatcacgcagttcttcagtggctaaaggaggggctgcca
gacctgtcagtctctcgaaggagcagccacttgcattgggtgcccggggacgactcgcag
accatctacgtatggctggatgccttggtcaactaccttactgtaattggctacccaaat
gctgagttcaaatcttggtggccaaccacctctcatatcataggcaaggacattcttaaa
ttccacgctatctattggcctgccctcctcttaggggccggcatgagcccaccacaccgc
atctatgtccactcacactggacggtctgtggccaaaagatgtccaaaagcttgggcaac
gtggtggatcccaggacttgccttgatcgctatactgtggatggcttccgatactttctt
cttcggcagggcgtccccaactgggactgtgattactatgatgaaaaggtggttaagttg
ctagattccgagttggcagatgctttgggaggtctcttgaaccggtgtactgccaataga
ataaatccttctgggacctatccggttttctgcactacctgctttcccagtgagccaggg
ttggtggggccgtcagttcgtgctcaggcagaggactatgctttggtgaatgcagtggcc
actctgcccaagcaggtagccgaccactatgataactttcagatctataaagctctggag
gcagtgtccagctgtgtccggcaaactaatggctttgtccaaaggcatgcaccgtggaag
ttgaactgggagagcccagtggatgccccctggctgggtactgtgcttcatgtagccttg
gaatgtttgcgagtctttggaactttgctccagcctgtcaccccaagcctagctgataag
ctgctatccaggttgggggtgtctgccacagagaggggccttggagagctctgtttcttg
cctcgattctatggacatccatgtccttttgaagggaggaggctgggacctgaaactggg
ctcttgtttccaagactagaccagtctagggcctggctggtaaaagcccataggacctag

DBGET integrated database retrieval system