KEGG   Panthera tigris altaica (Amur tiger): 102970812Help
Entry
102970812         CDS       T02988                                 

Gene name
THNSL2
Definition
(RefSeq) threonine synthase like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102970812 (THNSL2)
Enzymes [BR:ptg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     102970812 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 102970812
NCBI-ProteinID: XP_007082385
Position
Un
AA seq 484 aa AA seqDB search
MRYISTRGMAPRVDFEGALFSGYAPDGGLFMPEELPQLSIETLRQWSTLSYPGLVKELCT
LFIGPELIPRDVLNGLIDQAFSRFRHREVVHLSRLRNGLNVLELWHGVTYAFKDLSLCCT
AQFLQYFLEKKEKHVTVVVGTSGDTGSAAIESVQGAKNMDIIVLLPKGHCTKIQELQMTT
VLRENVHVFGVEGNSDELDEPIKAVFADVAFVKKHNLMSLNSINWSRVLVQMAHHFFAYF
QCVPSLDMDPLPRVEVVVPTGAAGNLAAGCIAQKMGLPIRLVVAVNRNDIIHRTVQQGDF
SLSEAVEQTLASAMDIQVPYNMERIFWLLSGSNSQVTRALMEQFERTQSVSLPKELHSKL
SGAVTSESVSDEAITQTMARCWEENKYLLCPHSAVAVSYHYQQTEQQPPSLPRCCLAPAS
AAKFPEAVLAAGLTPETPAEILALESKGTRCTPMRKGDDWKLMLRNTIEDISCQQRDHFL
NALE
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcggtacatcagcactcggggaatggccccccgggtcgactttgagggagccctcttc
tctggctatgctcctgatgggggtctcttcatgcctgaggagctcccccagctgagcata
gagaccctgcgtcagtggagtacgctgtcctaccctggcctggtaaaggagctgtgcacc
ctcttcatcggccctgagcttattccaagagatgtcttaaatggtctgatcgaccaagcc
ttcagcagattccgccacagagaagtggtccatctgtccaggttgaggaatgggctgaac
gtgttggagctgtggcatggcgtcacatatgcatttaaggacctgtccctgtgctgtaca
gcacagttcctgcaatacttcctggagaagaaggagaagcacgtcactgtggtcgtagga
acgtctggggacacagggagtgctgccattgagagtgttcagggggcaaagaacatggac
atcatcgttctgctgcccaagggccactgcacgaagattcaagagctccagatgacaaca
gtgttgagggagaacgtccatgtgtttggagtggagggcaacagcgatgagctcgatgag
ccgatcaaagctgtgtttgctgatgtggctttcgtcaagaagcacaacctgatgagcctg
aattcaatcaactggtcccgggtcctcgtgcaaatggcccaccacttcttcgcttatttc
cagtgcgtgccatccttagacatggaccccctgccccgcgtggaggtggttgtaccgaca
ggggctgcaggtaaccttgcagcggggtgcattgctcagaagatgggcctgcctatccgc
cttgtcgtggcagtgaaccgcaatgacatcatccacaggactgtccagcagggcgacttc
tctctttctgaggctgttgaacagaccttggcatcagcaatggacattcaggtgccctac
aacatggagagaatcttctggctgctctctggctccaacagtcaggtgacaagagccctc
atggagcagtttgaaaggacccaaagcgtgagcctacccaaggaactgcatagcaagctt
tcaggggcagtgacgtctgagtcagtgtcggatgaggccatcacccagaccatggctcgc
tgttgggaagagaacaagtacttgctgtgccctcactcggccgtggccgtgagttaccat
taccaacagacagagcaacagccgcccagccttccccggtgttgtctggcccccgcctct
gcagccaagttcccagaagctgtcctggctgccgggctgaccccagagacccctgcggag
atcctagccctggagagcaaggggacacgctgcaccccgatgcggaagggtgacgactgg
aagctgatgcttcggaacaccattgaggacataagctgccagcagagggatcacttcctg
aatgctctggagtag

DBGET integrated database retrieval system