KEGG   Panthera tigris altaica (Amur tiger): 102971364
Entry
102971364         CDS       T02988                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptg01009]
    102971364 (AKAP5)
Protein phosphatases and associated proteins [BR:ptg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102971364 (AKAP5)
SSDB
Motif
Pfam: WSK Amidohydro_3 NINJA_B
Other DBs
NCBI-GeneID: 102971364
NCBI-ProteinID: XP_007095266
Position
Un
AA seq 429 aa
MEATVSEIQVESKDEKRPTEVSPQDERQEEKASVLCFKRRKKAAKEMKPKASSKAAGAAR
TGLPEAGASDQPQAPVGAWASIKRLVTHRKRSEASKQQKPFEAKVQPEISAEDADLSRKK
AKSRLKIPCIKFSKGEKRSNHSKIIEDSDCSLRVQGEAERLDTEAPTQSDDQATTPKLPQ
DVSKAVSQKGGDEVCEPNVSHSTTAPGEKVIAVELGLDTGHSAIHTGTLVIERDTETTEE
KQRVQPQQASPLEPSETQQQLPVASDVPPSPAVPDQQIVEEAKSNILESGPNWKQHESGE
MVAEESEPKDTELSQESELRGNEVTAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNV
PKQFLISIENEQIGVFANDSGFEGRTSEQYETLLKETASSLVKNAIQLSIEQLINEMASD
DNKINNLLQ
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggaagccacagtttctgaaattcaagtcgaaagcaaggatgagaagagacccacagaa
gttagtcctcaagatgagcggcaggaggaaaaagcatcagtgctttgcttcaagagaaga
aagaaagcagccaaagagatgaagcccaaagctagctctaaagctgctggtgcagcaaga
acgggtctcccagaggcgggagcttctgatcagccccaggccccagtgggggcctgggcg
tcaatcaaacgtcttgtaacgcacaggaaaaggtcagaagcttcaaagcagcaaaagccc
tttgaggctaaagtgcaacctgaaatcagtgctgaggatgctgatctttctaggaaaaag
gcgaaatccagactcaagattccctgcataaaattctcaaaaggagagaaaagaagtaat
cattccaaaattatagaagactccgactgcagcctcagagtccagggagaggctgaacgt
ttggatacggaagctccgacccaatccgatgaccaggcaaccacgcccaagttgccccag
gatgtgagtaaagctgtctcacagaaagggggcgatgaggtctgtgagccaaacgtgagc
cacagcacaacggcacctggggaaaaagtgattgcagtagaacttgggttagacacgggg
cattctgccattcacacaggaacgctagtcattgaacgagatactgaaacaactgaggaa
aaacaacgcgttcaaccccagcaagcaagcccacttgaaccttcagaaacacaacagcaa
ctgccggtggcttctgatgttcctccctcacctgcagtcccagatcagcaaattgtggaa
gaagccaaaagcaatatcctagaaagtggaccaaattggaaacagcacgaaagtggagag
atggttgctgaagagagtgagccaaaagatactgaactgagccaggaatcagagcttaga
ggaaatgaggtcactgcagagaaaccaaaaccagaagaaagcaaaagaatggagccaatc
gctattattattacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtc
cctaagcaattcttaatttcaattgaaaatgagcaaataggggtttttgctaatgatagt
ggttttgagggtagaacttcagaacaatacgaaacactcttaaaagaaacggcttcttct
cttgtcaagaatgctattcagttgtctatagaacagctgattaatgaaatggcctctgat
gataataaaataaacaatcttctgcagtga

DBGET integrated database retrieval system