KEGG   Panthera tigris altaica (Amur tiger): 102971647Help
Entry
102971647         CDS       T02988                                 

Gene name
ACOD1, IRG1
Definition
(RefSeq) aconitate decarboxylase 1
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    102971647 (ACOD1)
Enzymes [BR:ptg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     102971647 (ACOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD TFIIF_alpha
Motif
Other DBs
NCBI-GeneID: 102971647
NCBI-ProteinID: XP_015399241
Position
Un
AA seq 470 aa AA seqDB search
MLKSVTESFARVIHGLTVEHLTDHVIQRSKRMILDTLGVGFLGTNTEVFHKASEYSKIYS
SNVASTVWGQPDLRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLLALSEALPP
SPKCSGLDLLLAFNVGIEVQGQLLRFSKEANDIPKRFHPPSVVGTLGSAAATSKFLGLSM
TKCREALAIAVSHAGAPIANAATQTKPLHIGNAARHGMEAAFLAMLGLQGNRQILDMQTG
FGAFYANYSPKVLPNLDSHAWLLDQQDVAFKRFPAHLATHWVADAAASVRKHLVTDRALL
PIDRIARIVLRIPDVQYVNRPFPDSEHEARHSFQFVACATLLDGGITVPSFHKCQINRPQ
VRELLSKVELEHPQDNLPSFNTLYCEISVTLNDGATFTERSDTFYGHWRKPLSQEDLREK
FRANASNVLSCDTVERLTEIVENLEDLEDCSVLTTLLKGPSSPEMVSKSI
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagtctgtcacagaaagctttgccagagtgatccatggcttgacagtggaacac
ctgacagaccacgtcattcagagaagcaagagaatgattctggatactctgggtgtcggc
ttcctgggaaccaatacagaagtgtttcacaaagccagtgaatatagtaagatctacagt
tccaatgtggccagcactgtttggggtcagccagacttaaggctcccgccgacatatgct
gcttttgtgaacggtgtggctattcactcaatggattttgatgatacatggcatcctgcc
acccacccttctggagcggtccttcctgtcctgctggctttatcagaagctctgcctcca
agtccaaagtgttctggccttgatctgctcttagctttcaatgttgggattgaagtgcaa
ggccaattactgcgtttctccaaggaagccaatgacataccaaagagattccatccaccc
tcagtggtaggaaccttgggtagtgctgctgctacatccaagtttttggggctcagcatg
acaaagtgccgagaggccctggctattgctgtttctcatgccggggcacccatagcaaac
gctgccactcagaccaagcctcttcatatcggcaatgctgccaggcatgggatggaagcc
gcttttctggcaatgctgggtctccaaggaaacagacaaatcttggacatgcagacaggg
tttggggccttctatgccaactattccccaaaagttcttccaaacctagattcccatgct
tggctgctggaccagcaggatgtggccttcaagcggttccctgcacatttggccacccac
tgggtggcagacgcagctgcatctgtgagaaagcaccttgtaacagacagagccctgctt
cccattgaccgcattgcaagaattgtgctcagaattccagatgtgcagtatgtaaacagg
cccttcccagactcggagcatgaggctcgtcattccttccagtttgtggcctgtgccaca
ctgcttgatggcggcatcactgtcccatcattccacaaatgccagatcaacaggccacag
gtgagggagttgctcagtaaggtggagctggagcaccctcaagacaacctgccaagcttc
aacacactatattgtgagataagtgtcactctcaatgatggagccaccttcacagagcgc
tctgataccttctatggccattggaggaagccattgagccaggaggacctacgggagaag
ttcagagccaatgcttccaacgtgctgtcctgtgatacagtagaaagacttacagagata
gtagagaatctagaagacctagaagactgttctgtcctaaccactcttctgaaaggacca
tcttcaccggagatggtttcaaaatccatctag

DBGET integrated database retrieval system