KEGG   Pelotomaculum thermopropionicum: PTH_0270Help
Entry
PTH_0270          CDS       T00519                                 

Gene name
PaaJ
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
pth00071  Fatty acid degradation
pth00280  Valine, leucine and isoleucine degradation
pth00362  Benzoate degradation
pth00620  Pyruvate metabolism
pth00630  Glyoxylate and dicarboxylate metabolism
pth00640  Propanoate metabolism
pth00650  Butanoate metabolism
pth00900  Terpenoid backbone biosynthesis
pth01100  Metabolic pathways
pth01110  Biosynthesis of secondary metabolites
pth01120  Microbial metabolism in diverse environments
pth01130  Biosynthesis of antibiotics
pth01200  Carbon metabolism
pth01212  Fatty acid metabolism
pth02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PTH_0270 (PaaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    PTH_0270 (PaaJ)
   00640 Propanoate metabolism
    PTH_0270 (PaaJ)
   00650 Butanoate metabolism
    PTH_0270 (PaaJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PTH_0270 (PaaJ)
   00072 Synthesis and degradation of ketone bodies
    PTH_0270 (PaaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PTH_0270 (PaaJ)
   00310 Lysine degradation
    PTH_0270 (PaaJ)
   00380 Tryptophan metabolism
    PTH_0270 (PaaJ)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PTH_0270 (PaaJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PTH_0270 (PaaJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PTH_0270 (PaaJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pth04147]
    PTH_0270 (PaaJ)
Enzymes [BR:pth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PTH_0270 (PaaJ)
Exosome [BR:pth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PTH_0270 (PaaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAF58451
UniProt: A5D5M9
Position
280576..281772
Genome map
AA seq 398 aa AA seqDB search
MANAVIVGGVRTAIGRIGGTLKNVQAEELAAHVIGEILKRTEVEGREVDEVILGQAKQSC
DAPNIARVSSLMAGLPIEVPAYTVHRQCGSGLQALINAAQQIRLDESGIIVAGGVESMST
APYYLRFARYGYGAGNGEILDPNTESQPRSQPESCYGRLTMGMTAENLAVKYSISRAEQD
EFALWSQEKAWAAIESGRFRPEITPFTVDSGKGKSTVFDTDEHPRKTSLEALSKLKPAFK
ENGTVTAGNSSGRNDGAAAVVMMAEEKARERGLFPYFRVVSYAASAVSPEIMGIGPVYAT
RRALDRAGLRLEDIDLIELNEAFAAQSLAVLRELQPDRERVNVNGGAIALGHPLGMSGAR
LVVTLIHEMVRRDSRYGLATLCIAGGQGLAMIVEKVKN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgctgttattgtgggaggagtgcgcactgccatcgggcgcatcgggggcacc
ttgaaaaatgtccaggcagaggagctggccgcccacgtaatcggtgaaatattgaaaaga
acggaagtggaagggagagaagttgacgaggtaattctgggccaggccaagcaaagctgt
gacgcccccaatattgcccgggtttcctctttgatggccggcctgcccattgaggtgccg
gcctacaccgtgcaccgccagtgcggttcaggtctgcaggccctgattaacgcagcccag
cagatcaggctggacgaatccgggataatcgtggcaggcggggtggagagcatgagcacc
gctccctattacctccgctttgcccgctacggctacggcgcgggaaacggcgaaatactt
gacccgaatacggaaagccagccccgctcgcagccggagagttgttacggccgtctgacc
atgggcatgaccgccgagaatctggccgttaaatacagcatcagccgcgccgagcaggac
gagtttgccctctggagccaggagaaggcctgggccgccattgaaagcggcaggttccgc
ccggaaattacgccttttaccgttgattcgggcaaagggaagagcacggttttcgatacg
gacgagcatccccgcaaaaccagcctggaggctttaagcaagcttaaaccggcttttaag
gagaacggcacggttaccgccggaaactcttccgggcggaacgacggggcagcggccgta
gtcatgatggcagaggaaaaggccagggaaagagggttattcccttatttccgggtggtt
tcctatgcggcatcggctgtcagcccggagataatgggcatcgggccggtttatgcaacc
cgcagggcgcttgacagggccggcctgcggctggaggatatcgacctgatcgagctgaac
gaggcttttgcggcgcagtcgctggcggtactaagggaactgcaacctgaccgggaacgg
gtcaatgtaaacggcggggcaattgccctcggccacccgctggggatgtcaggagcaagg
ctggtggttacgcttattcacgaaatggtccggcgggacagccgttacggcctggccact
ctttgcattgccggcggccagggcctggccatgattgtcgagaaggtaaaaaactga

DBGET integrated database retrieval system