KEGG   Pelotomaculum thermopropionicum: PTH_0325Help
Entry
PTH_0325          CDS       T00519                                 

Gene name
RplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pth  Pelotomaculum thermopropionicum
Pathway
pth03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pth00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PTH_0325 (RplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pth03011]
    PTH_0325 (RplV)
Ribosome [BR:pth03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    PTH_0325 (RplV)
  Bacteria
    PTH_0325 (RplV)
  Archaea
    PTH_0325 (RplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: BAF58506
UniProt: A5D5J5
Position
331894..332235
Genome map
AA seq 113 aa AA seqDB search
MEAKAVARYIRISPRKVRQVVDLIRGKKLNEALAILRYTPKRASAVVAKVVRSAAANAEN
NLQMDRDELFIKACYVDQGPTYKRYMPRAFGRADVMRKRTSHITVVVSDKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
ttggaagctaaggctgtagccaggtatataaggatttccccgcgcaaggtgcgccaggtg
gtggacctcatccggggcaagaagctgaacgaggccctggctattttaaggtacacgccc
aaacgggcctctgcggttgtggccaaggttgtcaggtcggcggcggcaaatgccgaaaac
aacctgcaaatggacagggacgaattgttcataaaggcgtgttacgtcgaccaggggccc
acgtacaagcgttacatgccgcgggcctttggccgcgccgacgtcatgcgcaagcgcacc
agccacatcaccgtagtggtcagcgacaagaaggagggataa

DBGET integrated database retrieval system