KEGG   Pelotomaculum thermopropionicum: PTH_0505Help
Entry
PTH_0505          CDS       T00519                                 

Gene name
CarB
Definition
(GenBank) carbamoylphosphate synthase large subunit
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
pth00240  Pyrimidine metabolism
pth00250  Alanine, aspartate and glutamate metabolism
pth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pth00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    PTH_0505 (CarB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PTH_0505 (CarB)
Enzymes [BR:pth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     PTH_0505 (CarB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 Dala_Dala_lig_C ATPgrasp_Ter ATP-grasp MGS ATP-grasp_3 GARS_A ATP-grasp_4 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: BAF58686
UniProt: A5D508
Position
489954..493205
Genome map
AA seq 1083 aa AA seqDB search
MPRRKDIRKVLVIGSGPIIIGQAAEFDYAGTQACKALREEGVSVVLVNSNPATIMTDLDI
ADQVYIEPLAWDSVAEIIARERPDGLLPTLGGQTGLNIAVELSEKGVLQDYGVELLGTPL
ESIKKAENRELFKNLMLEIGEPVPRSTIAGSVEECLAFAGEIGYPVIVRPAYTLGGTGGG
IACREQELVEIAGRGLKMSMIGQVLLEQSVAGWKEIEYEVMRDGADNCITVCNMENVDPV
GIHTGDSIVVAPSQTLSDKEYQLLRSAALRIIRALKVEGGCNVQFALDLNSMAYYVIEVN
PRVSRSSALASKATGYPIAKVAAKIAVGLTLDEIKNPVTGKTYACFEPALDYVVVKIPRW
PFDKFGSADRTLGTQMKATGEVMAIDRTFEGALMKAVRSLEIGVDGLHLPGSAGWSEMEL
EEKLSYPNDLRLFAIAEAFNRSWGMREVAQLTTIDYFYLSKIRGIVELERELQAAGPRPP
RELLRRAKSCGLPDSLIGRLTGLPAREVHALRKEYGILPAFKIVDTCAAEFEAVTPYYYS
TYDDEDEVAVSGRPKVLVLGSGPIRIGQGIEFDYCSVHSVWGLQQEGIEAVIINNNPETV
STDFDTADKLYFEPLTLEDVLNVIEKEKPLGVIVQFGGQTAINLTAGLAALGVNILGTPV
EGIDAAEDRDKFEKLLTGLGIPQSEGRSAVNVEEAQAVAEKLGYPVLVRPSYVLGGRAME
IISSKTELVKYMTEAVQVSPRHPVLVDKYIRGKEVEVDAIGDGNDLFIPGIMEHIERAGV
HSGDSIAVYPPQTLSREEIDKIVEYTLKIGRALKINGLINIQYVVDNGGVYVLEVNPRAS
RTVPVLSKVTGVPMVQAATRAMLGRSLAELGYRPGLGPVGGFIAVKAPVFSFEKLGLVEI
SLGPEMKSTGEVMGIDRSFPGALYKAMRAAGLKVASGGRVVFSVADRDKAEAVSIAGEYA
ALGYTLHATPGTARALEKAGLEVEVVEITDPVPLIRSGTVGLIINTPTRGKVPGRPGFLL
RRTAAEYRVPCLTSLDTARALAMVLRSVRWGGEPAPVSMAELFEKEGTANCCLRKKDSKA
AIF
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgcccagaagaaaagacataaggaaagtcctcgtgatcggttccggaccgataattatc
ggccaggcggccgagttcgactacgccggcacccaggcctgcaaggccctgcgggaggaa
ggcgtatcggtggtgctggtcaactccaacccggccaccatcatgaccgacctggacatt
gccgatcaggtttacatagagccgctggcatgggacagcgtggccgaaatcattgcccgc
gagcggccggacggcctgctccccaccctgggcggccagaccggcctgaacatagccgta
gagctttcggaaaaaggggtgctgcaggactacggggtggagcttctgggcactcccctg
gagtccataaaaaaggccgaaaaccgggagctgtttaaaaatttaatgctggaaataggc
gagccggtgcccaggagtaccatagccgggagcgtggaggaatgcctggcttttgccggg
gagatcggctacccggtcattgtgaggccggcctacactctgggaggcaccggaggcggc
attgcctgccgggagcaggaactggtcgagatagccggcaggggcctgaagatgagcatg
atcggccaggtcctgctggagcagagcgtggccggctggaaggaaatcgagtacgaggtg
atgcgggacggcgcggacaactgcattaccgtctgcaatatggaaaacgtcgacccggtg
ggcatccataccggcgacagcattgtcgtggccccgtcgcagaccctttccgacaaggag
taccagcttttgcgctcggcggccctgcggattatccgggcgctgaaggtggagggcggc
tgcaacgtgcagtttgcccttgaccttaacagcatggcctactacgtaatcgaagtaaac
ccccgggtcagccgctccagcgccctggcttccaaggccaccggctaccccattgccaag
gtggcggctaagattgccgtcggactgaccctggatgagataaaaaacccggttaccggc
aaaacgtatgcctgttttgagccggccctggactacgtggtggtgaaaataccgcgctgg
ccgttcgacaagttcggcagcgccgaccggaccctgggcacccagatgaaggccaccggc
gaggtgatggccatcgaccgcacctttgagggggcgctgatgaaggcggtgcgctccctg
gagataggcgtggacggactgcacctgccgggctcggcggggtggtctgaaatggaactg
gaggaaaagctttcttaccccaacgacctccgcctttttgccattgccgaggccttcaac
cgctcctgggggatgcgcgaggtggcccagttgaccactatcgactacttttacctgagc
aagatcaggggcatagtggagcttgagcgcgagcttcaggcggcaggccccaggcctccc
agggagcttttgcgccgggccaagtcctgcggcctgcccgactccctgatcggccgcctg
accggcctgccggcgcgggaggtgcacgccttgcggaaggagtacggaatcctgcccgcc
ttcaaaattgtggacacctgcgcggccgagtttgaagcggtcactccttactactattct
acttacgatgatgaggacgaggtggcggtttccggccgcccgaaggtgctggtgctgggc
tccggcccgatccggatcggccagggaatcgagttcgactactgctcggtccattcggta
tggggcctgcagcaggaggggatagaggccgtaatcatcaacaacaacccggagacggtc
agcaccgactttgatacggccgataagctttattttgaaccgctgaccctggaggacgtc
ttaaacgtcatagaaaaggaaaagcctttgggggtaatagtccagttcggcgggcagacg
gccatcaacctcactgccggcctggcggcgctgggggtaaacatcctcggcacccccgtg
gaagggatagacgctgcggaagaccgggacaaatttgaaaagcttctgaccggcctgggc
attccccagtccgagggcaggtccgccgtcaacgtggaggaagcccaggccgttgccgaa
aagctgggctatcccgtgctggtgcgcccgtcctacgtcctgggagggcgcgccatggag
ataatatccagcaaaaccgaactggtgaaatacatgacggaggccgtgcaggtgtcaccc
aggcacccggtgcttgtggataaatacatccgcggcaaggaggtggaggtggacgccatc
ggcgacggcaatgacctcttcatcccggggataatggagcacattgagcgggccggtgtg
cactcgggggacagcatagccgtctacccgccccagacgctgagccgggaggaaatagat
aaaattgtggaatatactttaaagataggccgggcgctcaagattaacggcctgatcaac
atccagtacgtggtggacaacggcggggtatacgttctggaggtgaaccccagggcttcc
cgcacggttcccgtgctgagcaaggtcaccggggttcccatggtccaggcggcaaccagg
gccatgctggggcgcagcctggccgaactgggctaccgcccggggctggggccggtgggc
ggcttcattgcggttaaggctccggttttctcctttgagaaactggggctggtggagatt
tccctggggccggaaatgaagtctacgggagaggttatgggcatcgaccggtctttcccc
ggcgccctctacaaggccatgcgcgccgccggcctgaaggtggcttccggcggccgggtg
gtgttttcggtggccgaccgcgacaaagctgaagccgtctccattgccggcgagtacgcc
gccctcggctacaccctgcacgccactcccggtacggccagggccctggaaaaggccggc
ctggaagtggaagtggtcgagataaccgaccccgttcccctgatccgctccgggacggtg
ggcctgataatcaacactccgaccagggggaaggtgcccggccggcccggtttcctgctg
aggaggaccgccgccgagtacagggtgccgtgccttacctcgctcgacacggccagggcg
ctggcaatggtgctgcgcagcgtcaggtggggcggcgaaccggcgccggtgagcatggcc
gaactttttgagaaagaagggactgccaattgctgtctgagaaagaaagattcaaaggcc
gccatcttttaa

DBGET integrated database retrieval system