KEGG   Pelotomaculum thermopropionicum: PTH_0660Help
Entry
PTH_0660          CDS       T00519                                 

Gene name
Alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
pth00473  D-Alanine metabolism
pth01100  Metabolic pathways
pth01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pth00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PTH_0660 (Alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PTH_0660 (Alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pth01011]
    PTH_0660 (Alr)
Enzymes [BR:pth01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PTH_0660 (Alr)
Peptidoglycan biosynthesis and degradation proteins [BR:pth01011]
 Precursor biosynthesis
  Racemase
   PTH_0660 (Alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAF58841
UniProt: A5D4I1
Position
648468..649592
Genome map
AA seq 374 aa AA seqDB search
MSIFPVWAEINLRAIAHNIREIRRVTEPGAKVMAVVKANAYGHGAEEVSQTALAGGAEWL
GVARVAEGVSLRQAGIEAPVLVLGYTTPEQAADVIRHNLSQTVYTRNAALFLAEAAAREG
KRARVHFKVDTGMGRIGWLAGPGAVREILELARLPQLEVEGIFTHFAAADAADKRYTLEQ
FQKFIEMIDELQKNGLEFPLRHAANSAAIMELPGTHLDMVRAGIILYGLYPSDEVDRRRI
DLRPAMSLKARVAHVKEVPAGFKVSYGCTYTTGRPGVIATLPLGYADGYSRLLSSKGEAL
IHGRRAPVVGRVCMDQVMVDVSGIPGVKAGDEAVLIGRQGGETISADEVAAKLGTINYEV
TCMVSGRVPRVYIR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttttccggtttgggcggagataaatttaagggccatagctcataacataagg
gagatccgcagggtgaccgaacctggggcgaaggttatggcggtggtcaaggccaatgcc
tacggccacggggcggaggaggtcagccagaccgccctggccggcggggccgaatggctg
ggagtggccagggtggccgaaggcgtgtccctgcgccaggctggaattgaggcgccggtg
ctggtgctgggctacaccacgcccgaacaggccgcagatgtgatccggcataatctgtcc
cagacggtttatacccgtaatgccgccttgttcctggcagaggcagccgccagggaaggg
aagcgggcgcgggtgcatttcaaggtagatacgggcatggggcggatcggctggctggcc
ggccccggcgccgtgcgggagatcctggaactggcgcggcttccgcaactggaggtggag
ggaattttcacccactttgccgccgccgatgccgccgacaagaggtataccctggagcag
tttcaaaaatttattgagatgattgatgaactgcaaaaaaacggtctggaatttcccttg
aggcacgccgcaaacagcgctgccataatggaactgcccggaactcacctggacatggta
agggccggcatcatactgtacgggctttacccatcggacgaggtggaccgccgccgcatc
gacctgcggccggccatgagcctgaaggcgcgggtggcgcacgttaaggaggtgcccgca
gggttcaaggtcagctacgggtgcacctacactaccggacggcccggtgtgatagccacc
ctgcccctgggctacgccgacggttattccaggcttctgtcctcgaagggagaggcgtta
attcacggccggcgggcgccggtggtaggccgggtgtgcatggaccaggttatggtggac
gtgagcggtattcccggggtgaaggcgggagatgaggcggtccttatcggccgtcagggc
ggtgagacaatatcggcggatgaggtggctgcaaagctcggaacgatcaattacgaagtg
acctgtatggttagcggcagggtgccgcgggtgtatattcgctga

DBGET integrated database retrieval system