KEGG   Pelotomaculum thermopropionicum: PTH_1174Help
Entry
PTH_1174          CDS       T00519                                 

Definition
(GenBank) hypothetical protein
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
pth00620  Pyruvate metabolism
pth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PTH_1174
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pth02000]
    PTH_1174
Enzymes [BR:pth01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     PTH_1174
Transporters [BR:pth02000]
 Other transporters
  Primary active transporters [TC:3]
   PTH_1174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H HlyD_3 Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: BAF59355
UniProt: A5D314
Position
1210109..1212088
Genome map
AA seq 659 aa AA seqDB search
MRRVKITDTTLRDAHQSLWATRMTTADMLPVAEKLDKIGYHSIEVWGGTTFDVCLRYLNE
DPWERLRQLKKIIRHTPLQMLIRGQSLVGYKHYPDDVVESFVTKAVENGINIIRVFDALN
DIRNLETAMRAGKAAGAHVQAAMVYTVSPVHTGQHYLELALRLAEMGADSICLKDMAGLL
DPYRAYELVKLLKENLDLPLQCHCHYIGGLAFGTYLKAVEAGADVIDTATLPLAFGASLP
PVETVVRALQGSPYDTGLNIRELFEIAKYFEELRKENGFKRGVTRINDMRVFDHQVPGGT
ISNLVTQLEEQKSLYRLGEVMEEIPRVREELGYPPLVTPASQIVGTQAVLNVLTGERYKL
VPGEVRDYIRGSYGTPPAPINREIARKVLGDREPVTCRPADLLEPVMGKIRNEVGELALS
EEDVISYALFPQVARRFLELRRSGGLGRPEPQNEKNVNMRVNNAARAGAGVPAGTAKESS
AKKVAQVPPAEAGSAGTVEKEAGELNLHDIRELIRLIDETSITEVSLENAGLRVAIKKGG
TCGVKAAGPEPEQKVQTVPRDTTEEEPAKTARPADNLKAGAVPVVSPMVGTFYRSPAPDA
PPFVKVGDRVQKGQTLCIIEAMKLMNEIEAEVSGEIVEILVENGQPVEYGQTLFLIKEK
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcagggtgaaaatcaccgatacaactttaagggacgcccaccagagcctttgggcg
accagaatgaccacggccgacatgctgccggtcgccgaaaaactggacaagattggctac
cactccattgaggtgtggggcggcacgacttttgacgtctgcctgaggtacttaaacgag
gacccgtgggaaaggcttcgccagttaaaaaagatcatccggcacacgccccttcaaatg
ctgatccggggacagtctctggttggatacaagcattacccggatgacgtggttgaatca
tttgttacaaaagccgttgagaacggcattaacataatcagggtgtttgatgctttaaac
gatatccgcaacctggagacggcaatgcgcgccggcaaggcggccggggcccacgttcag
gccgccatggtctatacggtcagcccggttcacaccggccagcactatcttgaactggcc
ctaaggctggccgagatgggcgccgactcgatctgtctcaaagacatggccggcctgctg
gatccctaccgggcctacgaactggttaaattattaaaggaaaacctggatctgcccctt
caatgccactgccattatataggcgggctggccttcggtacttacctgaaggcggtggaa
gcgggggcggacgttatcgataccgccaccctgcctctggccttcggggcctccctgccg
cctgtggagacggtggtgcgggccctgcagggctctccttacgacacggggcttaatatc
cgcgagctttttgaaatagccaagtattttgaggagttaaggaaagagaacggatttaaa
cggggtgttaccaggattaacgatatgcgcgttttcgaccaccaggtcccggggggtaca
atttccaacctggtaacgcaactggaagagcaaaaatcgctttaccgcctgggcgaggtg
atggaggaaattcccagggtgcgcgaagagctgggatacccgccgcttgttactccggcc
agccagattgttggaacacaggccgtcctcaacgtcctgaccggcgaaaggtacaagctg
gttccgggggaggtgcgggactacatcagaggcagttacggcacccctcccgccccgata
aaccgggagatagcccgcaaggtgctgggcgaccgcgagccggtcacctgcaggccggca
gacttacttgagccggttatgggaaaaataaggaatgaggtgggcgagttggcgttaagc
gaggaggatgtaatttcttatgctttatttccacaggtggccaggcgctttctggagtta
aggcgcagtggcggattgggcaggccggagccccaaaacgaaaagaatgtaaacatgcgg
gtaaataatgcggccagggcgggggccggcgtcccggcagggacggcaaaggaaagcagt
gcaaaaaaagttgcccaggtgccgccggccgaagccggcagcgccggaacagttgaaaag
gaggcaggcgagttgaaccttcacgatataagggaattgatcaggctgattgacgaaacc
agcataaccgaagtttcgctggagaatgcagggctacgagtagccattaaaaaaggcggc
acctgcggggtaaaagcggcggggcccgaaccggagcaaaaagttcagacagttccgcgg
gatacaacagaggaagaaccggccaaaacggccaggcccgccgataacctcaaggccggg
gcggttccggtggtatcgcccatggtggggacgttttaccgttcgccggcgcctgatgca
ccaccctttgtcaaggtgggagacagggtccagaagggacagactctttgcattatcgaa
gcgatgaagctgatgaacgaaattgaggccgaggtatccggggaaattgttgagattctg
gttgaaaacggccagccggttgaatacggtcagactctttttctcataaaagaaaaataa

DBGET integrated database retrieval system