KEGG   Pelotomaculum thermopropionicum: PTH_1623Help
Entry
PTH_1623          CDS       T00519                                 

Gene name
TrpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
pth00260  Glycine, serine and threonine metabolism
pth00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pth01100  Metabolic pathways
pth01110  Biosynthesis of secondary metabolites
pth01130  Biosynthesis of antibiotics
pth01230  Biosynthesis of amino acids
Module
pth_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PTH_1623 (TrpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PTH_1623 (TrpA)
Enzymes [BR:pth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PTH_1623 (TrpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB TP_methylase
Motif
Other DBs
NCBI-ProteinID: BAF59804
UniProt: A5D1S2
Position
complement(1714532..1715353)
Genome map
AA seq 273 aa AA seqDB search
MTGRSRIAKCLENLRAAGKKGLIAFITAGDPGLAGTVEIVRHVAEAGADLIELGIPFSDP
IADGPVIQMASARALAAGATLPGILEAVREIKKVCTKPLLLMGYYNPIYRFGIRQFAAAA
SVAGVDGLIVPDLPYEETRPLREAATEKGMDLIYLVAPVTPDRRLMKIAAEASGFIYCIS
VTGVTGARREIDTDLAAFTGRVRRYTALPLALGFGISGPEQALKASAYCDAVVVGSALVK
AVAECSDAAAAGLAAGQLVARIRAALDSLKGSF
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggcggagcaggattgcaaaatgtctggagaatttgcgtgcagcaggaaaaaaa
gggctgattgcttttatcaccgcgggcgatcccggcctggcaggcacggtggagattgta
cggcacgtggcagaagcaggggcggatctgattgaactggggattcctttctccgatccc
atagccgacgggccggtaatccagatggcttccgcccgggcgctggccgccggcgcaacc
ctgcccgggattctcgaagccgtaagggaaattaaaaaagtatgtacaaaacccctgctc
ctgatgggttactacaatcccatctatagatttgggatacggcagtttgcggccgcagct
tcagttgcaggtgtggacggcctgatagtgcccgacctgccctatgaagaaactcggccg
ctgcgggaagcggcaacggaaaaaggaatggaccttatttaccttgttgcgcccgtcact
ccggacagaaggctgatgaaaattgcagcagaggccagcggctttatttactgcatctcc
gtgacaggggtaaccggggcaagaagggaaattgacacggatctcgccgcttttacggga
agggtgcgccgttataccgccctgccgctggccctggggttcggcatatcaggcccggaa
caggcgctaaaggcttccgcatattgtgatgcggtggtggtaggaagtgctctggtaaaa
gcagttgcagaatgcagcgatgctgcagcagcagggctggcggcaggacaactggttgcc
cggatcagggcagcgcttgacagcctgaagggatctttctag

DBGET integrated database retrieval system