KEGG   Pelotomaculum thermopropionicum: PTH_2604Help
Entry
PTH_2604          CDS       T00519                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
pth00030  Pentose phosphate pathway
pth01100  Metabolic pathways
pth01120  Microbial metabolism in diverse environments
pth01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PTH_2604
Enzymes [BR:pth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     PTH_2604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N Proteasome
Motif
Other DBs
NCBI-ProteinID: BAF60785
UniProt: A5CZ02
Position
complement(2709820..2711544)
Genome map
AA seq 574 aa AA seqDB search
MKFIRVDMTTKQVKVEEVPQKYAGLGGRGLTSMFVADEVKPTCHPLGKNNKLIFAPGLLT
GTTAANSGRISVGAKSPLTGTIKESNSGGSFSQKMARMGIKALVIEGLPAEDKFFVIKVT
MDGVTIEDAPAEIIGKGNYEAIRVLNAKYGDKVGIALAGPAGEMRLPAANISFKDPDGNI
RSAGRGGLGAVMGSKKVKAVVIDDTGAPGVSVKDPEAFRAAAKRFAKALQDHPVTGQGLP
AYGTDVLVNILNEAGGLPTQNFRRGRNEWANDIGGETLAATIESRGGKPTHGCHAGCIIR
CSQWYVDKAGKYITSGFEYETIWGLGANSCIKNLDDIAYIDRAMDDVGVDSIETAVTIAV
AMDAGVIPWGDGKAALDLVEQIGKGTPLGRIIGSGAAVAGKCFGMTRVPVVKNQAIPAYD
PRAVKGVGLTYATTPMGADHTAGYAVATNVLKVGGFVEPLQKGGQAELSRNLQIATAAVD
STGMCLFIAFAILDIPDGFNALIDMINAMYGLSLTADDVTALGKSILKAERGFNERAGFT
KAHDRLPEFFEEECPPHNTTWDFTDEEIDEVFNF
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcatccgcgtggacatgacgacaaagcaggtaaaagttgaagaagttccccag
aagtacgccggactaggcggccgcggccttacttccatgtttgtggccgacgaagtgaag
ccgacctgccatcccctggggaagaacaacaagctcatttttgccccgggccttctgacc
ggcaccaccgctgccaactccggccgtatttcggtgggcgccaagagcccgctgaccggc
accattaaggagagcaactctggcggttcgttttcccagaaaatggccaggatgggcatc
aaggccctcgttattgagggactgccggcggaggacaagttctttgttattaaagtaacc
atggacggcgtaacaattgaagatgctccggccgagataatcggcaagggcaactacgag
gcaatcagggttttaaatgcaaagtacggggataaagtcggcattgccctggccggtcct
gccggcgagatgaggcttcccgcggcgaacatttcctttaaggaccccgacggcaacatc
cgcagcgccggccgcggcgggctcggagcggttatgggctccaaaaaggtgaaagcagtt
gttattgacgataccggagcacccggcgtttccgttaaagacccagaagccttcagggcg
gctgcaaagagatttgccaaagccctgcaagatcaccccgttaccggacagggcctgccc
gcctacggtactgacgttctggtcaacatcctgaacgaggccggcggccttcccactcaa
aacttccgccggggccggaacgaatgggccaacgatatcggcggcgaaacgctggccgca
accattgaatcacgcggcggcaaacccacccacggttgccatgccggctgcatcatccgc
tgctcccagtggtatgttgacaaagcaggcaaatacatcaccagcggttttgagtacgag
accatttggggcctgggcgccaattcctgcattaagaacctggacgacattgcttacatc
gaccgcgccatggacgatgtcggcgtggacagcattgaaactgccgtcaccattgccgtg
gctatggacgccggggttattccctggggcgacggcaaggcagcgctggatctggtcgag
cagatcggtaaaggcaccccgctgggccggattatcggttccggtgccgccgttgccggc
aagtgcttcggcatgaccagggttcccgttgtgaagaaccaggccatcccggcttacgat
ccgcgtgcggttaaaggcgtcggcctgacctacgccaccaccccgatgggcgccgaccat
acggcaggatatgccgttgccaccaacgtccttaaggtcggcggctttgtcgagccgctg
cagaagggcggccaggcggaactgtcccgcaacctgcagatcgctaccgccgctgttgac
agcaccggcatgtgcctgtttattgccttcgccattctggacattccggacggcttcaac
gccctgatcgacatgatcaacgccatgtacgggctctcccttaccgcggacgatgtaacc
gccctcggcaagtccatcctcaaggcagagcgcggcttcaacgaaagggccggcttcacc
aaagcccacgaccgcctgccggagttcttcgaagaagaatgtcctcctcataacaccacg
tgggacttcacagacgaagaaattgacgaagtttttaacttctaa

DBGET integrated database retrieval system