KEGG   Pelotomaculum thermopropionicum: PTH_2734Help
Entry
PTH_2734          CDS       T00519                                 

Gene name
NagC
Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
pth00010  Glycolysis / Gluconeogenesis
pth00052  Galactose metabolism
pth00500  Starch and sucrose metabolism
pth00520  Amino sugar and nucleotide sugar metabolism
pth00521  Streptomycin biosynthesis
pth01100  Metabolic pathways
pth01110  Biosynthesis of secondary metabolites
pth01120  Microbial metabolism in diverse environments
pth01130  Biosynthesis of antibiotics
pth01200  Carbon metabolism
Module
pth_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTH_2734 (NagC)
   00052 Galactose metabolism
    PTH_2734 (NagC)
   00500 Starch and sucrose metabolism
    PTH_2734 (NagC)
   00520 Amino sugar and nucleotide sugar metabolism
    PTH_2734 (NagC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PTH_2734 (NagC)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PTH_2734 (NagC)
Enzymes [BR:pth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PTH_2734 (NagC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: BAF60915
UniProt: A5CYL2
Position
complement(2833342..2834355)
Genome map
AA seq 337 aa AA seqDB search
MNSFYVIGVDLGGTKIYTALAADDGRVLSEIKLPTEAGRGLQGVIDRIVHSVEQVRENVA
VPPQKVLALALGAPGPLDTAGGVIHFAPNLRWNNVPIRQILEERLSLPVLLDNDANLAAL
GEHVFGAGRGCGNMVYITVSTGVGGGLILDGKLYRGSSDGAGEIGHMTVLPDGPVCSCGN
RGCLEAMASGTAIARAAAELVASGGGRKILAAAGGDPGRINAAAVAAAAAGGDPEAAAII
DRAAGYLGIGVASILNLLNPAMVVLGGGVMEIGEPVWKGVRREVQARALQAARSRARLVP
AELGGRAGVMGAIALALQEIADGNCLPPAAAEHRNGR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagtttttacgtaatcggggtagatctgggcggcaccaagatttacacggccctg
gcggcagatgacggccgggttctttctgaaataaagctgcccacggaggcaggcaggggg
ctgcagggcgtgatcgaccgcattgtgcacagcgtggagcaggtgcgggaaaatgtggcg
gtaccgccgcagaaggtacttgccctggcccttggcgcaccgggccccctggacacggcc
gggggagtcattcattttgcccccaacctgcgctggaataacgttcccatcaggcaaatc
ctggaggaaaggctttccctgccggttctgctggataacgatgccaacctggccgccctt
ggcgagcatgttttcggggccggccggggctgcggcaatatggtttacatcaccgtcagc
acaggcgtgggcggcggcctgatcctggacgggaagctttaccgcggctcttctgacggt
gccggcgagatcggccacatgaccgtcctgccggacggaccggtctgcagttgcggcaac
cggggctgcctggaggcgatggcctccggcacggccattgcccgggcggccgcggaactg
gtggcaagcggcggcgggcggaagatcctggccgccgccggcggcgatccgggcaggata
aacgctgccgcggtagccgcggcggccgccgggggagaccccgaggcggccgcaattatc
gaccgggccgccggctatctgggcattggggtggccagcatcctgaatttgctcaaccct
gctatggtggtacttggcgggggcgttatggaaataggcgaacccgtctggaaaggcgtc
cgccgggaggtgcaggccagggcgctgcaagcggcaaggtcgcgggcccgccttgttccg
gctgagctgggcggccgcgccggggtcatgggcgcaatagccctggccctgcaggaaatt
gcagacggcaactgcctgcctcctgccgccgcggagcaccgaaatgggcggtga

DBGET integrated database retrieval system