KEGG   Phaeodactylum tricornutum: PHATRDRAFT_11281Help
Entry
PHATRDRAFT_11281  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00230  Purine metabolism
pti01100  Metabolic pathways
Module
pti_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PHATRDRAFT_11281
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PHATRDRAFT_11281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 RsgA_GTPase ABC_tran AAA_16 MMR_HSR1 Thymidylate_kin AAA_22 RNA_helicase AAA Roc
Motif
Other DBs
NCBI-GeneID: 7199897
NCBI-ProteinID: XP_002178734
JGI: 11281
UniProt: B7FVM9
Position
5
AA seq 169 aa AA seqDB search
MTDPLRPVVFCGPSGVGKGTLIEMLMRRFPDGQFGFSVSHTTREPREGETNGVQYNFTTK
EAIKNEIAEGNFIEYAEVHGKYYGTSVAAVESVRKQGKICILDIDVQGVQKVKESSLQPL
YLFISPPSMESLEKRLRGRGTETEDQMKMRLGNAAKELEYGYVKNGKND
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgacagatccattgcgccctgtagtcttttgcggcccatccggtgttggaaagggaacc
ttgatcgagatgctcatgaggcgattccccgacggccaattcggtttcagcgtttcacac
acaaccagggaaccgcgtgaaggagaaactaatggggttcaatataactttacgacaaag
gaggccataaagaatgaaattgcggaagggaactttattgagtacgccgaagtgcatgga
aaatactatggaacgagtgtggcggctgtggaatctgtccgaaagcaagggaaaatatgc
atcctggacattgacgtccagggagtgcaaaaggtaaaagaaagcagcctccaaccgttg
tatttgtttatttctccaccttcaatggaatcgctagaaaaacgccttcgtggccgaggt
accgagacggaagaccagatgaagatgagactaggaaacgctgcaaaagagctcgaatat
gggtatgtcaagaatggcaagaacgactaa

DBGET integrated database retrieval system