KEGG   Phaeodactylum tricornutum: PHATRDRAFT_11741Help
Entry
PHATRDRAFT_11741  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
pti  Phaeodactylum tricornutum
Pathway
pti03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:pti00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    PHATRDRAFT_11741
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pti01009]
    PHATRDRAFT_11741
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pti03036]
    PHATRDRAFT_11741
Protein phosphatases and associated proteins [BR:pti01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     PHATRDRAFT_11741
Chromosome and associated proteins [BR:pti03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     PHATRDRAFT_11741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: B56 Na_H_Exchanger DUF2122
Motif
Other DBs
NCBI-GeneID: 7199927
NCBI-ProteinID: XP_002179349
JGI: 11741
UniProt: B7FWA9
Position
6
AA seq 422 aa AA seqDB search
LPALRDGPPTKREELFVAKLKLCSVIFSFDDPTADKRGKDMKRQTLLELVDFVNTPAGQK
VFTESVMGDLMAMVSANVCRALPPATDDFDPEEDEPVLEPAWPHLQVAYEFFLRFIVSSE
VNAKAAKKYVDQKFCLQLVELFDSEDPRERDYLKTILHRIYGKFMSHRSFIRRAISNVFY
RFVYETERHNGIGELLEILGSIINGFAIPLKKEHLQFLARALIPLHKPKCVALYHQQLSY
CIIQYVEKDADTATPILNGFFKCWPWSNSGKQVMFLNELEEILELLGADQLAQVSTMLFT
NLARCLDSDHFQVVERALFLWNNEHLVNSGCLSRLNAQTVLPIIYGPLYKNSSGHWNATV
EGLAQNVLKMYMEYDLALYDRCTAAYFREEEEAKKKLEALQDKWALIEKEANSIAPALLL
AK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttacctgctctgcgggatgggccgccgacgaaacgagaagaattgttcgttgcgaagctc
aagctttgttccgttatcttttcgtttgacgaccccacggctgacaagcgaggcaaggac
atgaagcgtcaaactctccttgaactcgtagactttgtcaatactccggctggtcaaaag
gtctttaccgaatccgtcatgggcgatctcatggccatggtctccgctaacgtctgccgg
gcgctaccgcctgccacggacgactttgaccccgaagaagatgaacctgtcctggaaccc
gcttggcctcatctgcaagtcgcgtacgaattcttcttacgcttcattgtaagttccgaa
gttaacgcaaaggcggctaaaaagtacgtggaccaaaagttttgcctgcagctcgttgaa
ctctttgacagcgaggatccacgggaacgcgattacctcaaaaccatattgcaccggatc
tacggcaagtttatgtcgcaccgctcattcattcgacgggccatttcgaacgtcttttat
cgttttgtgtacgaaacggaacgccacaacggaatcggggagctcttggaaattcttgga
tccattatcaatggcttcgctattccgctcaaaaaggagcatttgcagttcttggcccgg
gcactgattcctttgcacaagcccaaatgtgtcgcattgtaccaccagcaactttcgtac
tgtattattcaatacgtggaaaaggatgctgacacggctacgcccatcctgaatggcttt
ttcaagtgctggccgtggagcaattcgggaaagcaagtcatgttcctgaacgaactcgaa
gaaattttggagttgctcggtgccgatcaactcgcccaggtgtcaactatgctttttaca
aatttggctcgttgtctcgattccgatcactttcaggtcgtcgaacgggctttgttttta
tggaacaatgaacatttggtgaattcaggttgcctgtcccgattgaatgctcaaacagtc
ctgccgattatctatggccctctctacaagaattcgtcgggacattggaatgcgacggtg
gaaggattggcccaaaatgtcttgaaaatgtacatggagtatgacctggctttgtatgac
cggtgcacggcagcctactttcgcgaagaagaagaggctaaaaagaaactggaagcgctg
caggacaaatgggccttgatcgaaaaggaggccaacagcatcgcacccgcgcttctattg
gccaagtga

DBGET integrated database retrieval system