KEGG   Phaeodactylum tricornutum: PHATRDRAFT_34672Help
Entry
PHATRDRAFT_34672  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
Organism
pti  Phaeodactylum tricornutum
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh DUF2788
Motif
Other DBs
NCBI-GeneID: 7200078
NCBI-ProteinID: XP_002179138
JGI: 34672
UniProt: B7FWC8
Position
6
AA seq 348 aa AA seqDB search
MSSTTTTPRTLHRKPKVVFLNAARLDYDQQLDWSRLRNLCDELTLGDRDTVTDEAELLRM
VQQQDIVVAKEMPVPAHILAQFPNTVRLICEAGTGYNNWPVALARKSRDLPVCNLPTYST
EAVAHMAVTYIMNFSVSMFRQQEMLRQGDRRNFTGPFTLPLRELNGSTVGLVSGAGRIGT
RVAHVCLALGMKVYVSSRAGQFAPDHTLYGHPDVVCTSDVDEVLRVADYVSIHTPLNEQT
RGSFGKAQIERMKPTAFLINTARGAVCAEDELVACLRDNVIAGAGLDVTATEPPAMDSPL
WDLPNCWLSPHTGWRRLETRQRLVDMTADNIEAFVNANSPKDYINVVN
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccacgactacgaccccccgcacgctccatcgcaaacccaaggttgtctttctg
aacgcggctcgtctcgactacgatcagcagctcgactggtcgcgtttgcggaatctttgc
gacgaactgactctcggtgaccgggacaccgtcacggacgaggccgagctgctacgcatg
gtccaacaacaggatatcgtcgtcgccaaggaaatgcccgtacccgcccacattctggca
caattcccaaacacggtccgactcatttgtgaagccgggacgggatacaacaattggccc
gtcgccttggcccgcaaaagccgggacctgcccgtatgcaaccttcccacctacagcacc
gaagccgtcgcgcacatggccgtcacctacattatgaacttttccgtcagcatgttccga
caacaagaaatgctccgacaaggggaccgccggaactttaccggacccttcacgctaccg
ctgcgggaactcaacggcagtacggtgggcttggttagtggagccggacgtatcggcacg
cgagtcgcccacgtctgtctcgcgctcggaatgaaggtttacgtttctagtcgggcagga
cagttcgctcctgatcacactctgtacggacaccccgacgtcgtgtgtaccagcgacgtc
gacgaggtcttgcgagtggccgattacgtttccatccatactcctttaaacgaacaaacg
cgaggcagctttggaaaggcgcagattgagcgaatgaaacccaccgcctttttaatcaac
accgcacggggggccgtctgtgccgaagacgaactcgttgcgtgtttgcgagacaacgtc
attgccggggccggactggacgtgaccgcgacggaaccgccggccatggacagtccgttg
tgggacttgcccaactgctggctctctccgcataccggatggcggcgactggaaacaaga
caacgactcgtggatatgacggccgacaatattgaagcctttgtcaatgccaacagtccg
aaagattacatcaatgtggtgaactga

DBGET integrated database retrieval system