KEGG   Phaeodactylum tricornutum: PHATRDRAFT_34800Help
Entry
PHATRDRAFT_34800  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
Organism
pti  Phaeodactylum tricornutum
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_7 Pyr_redox_2 ThiF AdoHcyase_NAD DpaA_N TrkA_N Pyr_redox Shikimate_DH XdhC_C 3HCDH_N IlvN ApbA
Motif
Other DBs
NCBI-GeneID: 7200351
NCBI-ProteinID: XP_002179420
JGI: 34800
UniProt: B7FWQ5
Position
6
AA seq 387 aa AA seqDB search
MYRYFHFCSTPGPITIEIRESQGRRRFIEANTASNGTSSTMATRVFWRFHARLTRPCRVV
YAGPHFQAGLSYTQALVRERGLEQCVELVHAPTDAQLWELAPTVDVAVPFMQSFRADFIE
RASRMRLIMQYGVGLEGVDVDSATKHGIAVSNIPAAGTGNAEATAEHAIFLSLSLLRRAF
QDLPQRFQGRILGGLPIPKSLFQKNVTVVGYGAVGSKICEYLNAMGAKVTVVRKHWTVEP
ERGIHKARSLGECLPTTDLLILACPLTTETFHMLNEETLSLLPRQGSLVVNIGRGPRVEH
SAVWRALNSGRVGGYASDVGVGHPVKPSEPWDPDDDLSRHANVLFTPHVGGYTYYSYNLM
CKAVVDAIDDVRCGRPPDMGKFQVEVD
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtacagatactttcatttttgttccacgccaggacccatcacaatagagattcgtgaa
tcacagggccgccggcggttcatagaagcgaacacggcctccaatgggaccagctctacc
atggcaacccgggtattttggcgctttcatgctcgcttgactcggccttgtcgcgtcgta
tacgcgggaccacatttccaagccggtctgtcgtacacgcaggccttggtgcgggagcgg
ggtctggaacagtgcgtcgaactcgtgcacgcccccaccgatgcgcaactgtgggaactg
gcacccacggtggatgtggcggtcccgtttatgcaatcgttccgtgccgattttatcgaa
cgggcgtcgcggatgcgcctgataatgcagtacggggtaggtttggaaggagtggacgtg
gactctgcgacgaagcacggtatcgccgtgtccaacatacccgcggccgggacggggaac
gcggaagcgacggcagagcatgctatttttctttcgctgagtttgctgcggagagcgttt
caggacttacctcagaggttccaaggacgcattctcggggggttgccgattccaaagtcg
ctttttcaaaagaatgtcactgtcgtgggctacggagctgttggttcaaagatctgcgag
tatctgaatgctatgggagcaaaggtgacagttgtacgaaaacattggacagtggaaccg
gagagaggcattcacaaggcaagatccctaggggaatgcctgcccacaaccgatctcctc
attctcgcgtgtccccttactaccgaaactttccatatgctgaacgaggaaaccctttca
ctcttacctcgtcaaggctcgcttgtggtgaatattgggagaggcccacgtgtggagcat
agtgcggtttggcgggctttgaattcaggtcgagtaggcggttacgcttcggacgttgga
gttggacatcctgtgaaaccgtcagaaccttgggacccagacgacgatttgagccgccat
gctaatgtgttgtttacacctcacgttggaggttacacttattacagctacaacctgatg
tgcaaagctgttgtggacgccattgacgatgtgcgctgtggtaggccccctgatatgggt
aaattccaagttgaggtcgactga

DBGET integrated database retrieval system