KEGG   Phaeodactylum tricornutum: PHATRDRAFT_42015Help
Entry
PHATRDRAFT_42015  CDS       T01075                                 

Gene name
SCS-alpha
Definition
(RefSeq) ligase succinate-coa ligase
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00020  Citrate cycle (TCA cycle)
pti00640  Propanoate metabolism
pti01100  Metabolic pathways
pti01110  Biosynthesis of secondary metabolites
pti01130  Biosynthesis of antibiotics
pti01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PHATRDRAFT_42015 (SCS-alpha)
   00640 Propanoate metabolism
    PHATRDRAFT_42015 (SCS-alpha)
Enzymes [BR:pti01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     PHATRDRAFT_42015 (SCS-alpha)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PHATRDRAFT_42015 (SCS-alpha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 7201458
NCBI-ProteinID: XP_002180696
JGI: 42015
UniProt: B7G0K7
Position
9
AA seq 309 aa AA seqDB search
MSSTAKVWVDKNSRVICQGFTGKQGTFHSTQAIDYGTNMVGGVTPKKGGQEHLGLPVFNT
VQEAVDGVQPDASVIYVPPPYAAQAILDAIEAEIGLVVCITEGIPQQDMARVKHALRLQD
RTRLIGPNCPGIIKPGECKIGIMPGYIHRPGKIGVVSRSGTLTYEAVWQTTVTGLGQSTC
VGIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGSAEEEAAEWLKEYGDPNKPVVGF
IAGLTAPPGRRMGHAGAIIAGGKGGAEEKFQALESAGVHVSRSPARLGATMLEAMGLEAP
ETPLEPQSA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaaccgccaaagtgtgggtggataagaacagtcgcgtgatctgtcaagggttc
accggaaaacagggaaccttccattcgacgcaagccattgattacggcaccaatatggtt
ggtggagtcacgccgaaaaaaggcgggcaggagcatctcggtctaccggtatttaacacg
gtccaagaagccgtcgacggggtacaaccggacgcctcggttatttacgtgccgcccccc
tacgcggcccaagccattctggacgcgatcgaggccgaaatcggactcgtcgtctgcatc
acggagggaattcctcagcaagacatggcgcgcgtcaaacacgccttgcggctacaagac
aggacacgcttaattggacccaattgtcccgggattattaaacccggtgaatgcaagatt
ggtatcatgccagggtacattcaccggcctgggaaaatcggtgtagtgtcgcggtcggga
acactaacgtacgaagcagtttggcaaactacggtaacgggactgggccagtcgacatgt
gtcggtattggcggggaccctttcaatggaaccaactttattgattgcttggaacgtttc
accaatgatcccgagacggaaggtatcatcatgatcggagaaattggtggatcggccgaa
gaagaagccgccgaatggctcaaggaatacggcgaccccaacaaacctgtggttggcttt
attgctggactcacagctcctccgggacgtcgtatgggacatgctggtgccattattgct
ggaggaaagggcggtgcggaagaaaagttccaggccctggagtctgctggagttcacgtg
tcgcgctctccagctcgtctcggagccaccatgctcgaagccatgggactggaagcgccg
gaaactccgcttgagccgcaaagtgcttga

DBGET integrated database retrieval system