KEGG   Phaeodactylum tricornutum: PHATRDRAFT_42832Help
Entry
PHATRDRAFT_42832  CDS       T01075                                 

Gene name
SOD2
Definition
(RefSeq) mutase superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pti00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PHATRDRAFT_42832 (SOD2)
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PHATRDRAFT_42832 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 7196432
NCBI-ProteinID: XP_002177253
JGI: 42832
UniProt: B7FPQ3
Position
1
AA seq 226 aa AA seqDB search
MSGSKIIVDSALRAAVNLRSSKIPTELAKSSAALFSAYGGAKKHELPTLTYDYASLEPAI
SAETMELHHSKHHNTYVTNLNVTLEKMDSALTSSDISALIGLQGALKFNGGGHLNHTLFW
DLESAIKESFGDFEKLKTEMSAKTVAVQGSGWGWLGYNKSTGRLEIATCANQDPLEATTG
LAPLLGIDVWEHAYYVDYRNVRPDYVKNIWDIINWDTVAQRLSATK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggagcaagatcattgttgattcggcgcttcgcgccgctgtcaaccttcgttct
tcgaaaatccccacagaattggccaagtcgagtgcagcgttgttctcggcttacggcgga
gcaaagaagcatgagctgccaactcttacttacgactacgcctccctcgaacctgccatt
tcggcagaaaccatggagttgcatcatagtaaacaccacaacacctacgttacgaactta
aacgttaccttagaaaaaatggacagtgctttgacttccagtgacatttctgctcttatt
ggactacagggagcattaaagttcaacgggggcggccacttgaaccacactcttttctgg
gatcttgagtcggcaatcaaggaaagctttggcgattttgaaaagttgaagaccgaaatg
agtgccaagactgttgcggtccagggaagcggatggggctggcttggttacaacaaatca
actggacgcctcgaaattgcgacttgtgcgaaccaggatcctttggaggccacgaccggc
ctcgcccctttattggggatcgacgtatgggagcatgcctactatgtcgattaccgtaac
gtgcgcccagattacgtgaaaaatatctgggacatcatcaactgggataccgttgcccag
cgtctctccgcaaccaagtaa

DBGET integrated database retrieval system