KEGG   Phaeodactylum tricornutum: PHATRDRAFT_43430Help
Entry
PHATRDRAFT_43430  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K12733  peptidyl-prolyl cis-trans isomerase-like 1 [EC:5.2.1.8]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pti00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    PHATRDRAFT_43430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pti03041]
    PHATRDRAFT_43430
   03110 Chaperones and folding catalysts [BR:pti03110]
    PHATRDRAFT_43430
Enzymes [BR:pti01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     PHATRDRAFT_43430
Spliceosome [BR:pti03041]
 Complex B
  Other components
   Prp19-related factors
    PHATRDRAFT_43430
 Complex C
    PHATRDRAFT_43430
Chaperones and folding catalysts [BR:pti03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    PHATRDRAFT_43430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 7197152
NCBI-ProteinID: XP_002177617
JGI: 43430
UniProt: B7FS77
Position
2
AA seq 184 aa AA seqDB search
MKDTNAPWTHVEFETSIGSFSIELYHKHTPRTCYNIAALAYQGYYNGTIFHRIIRDFMIQ
GGDPTGTGRGGESIYGGKFADEITRNLKHVGAGVVSMANAGPNTNGSQFFISLKPTPFLD
GKHTVLGRVYSGMSVVQRMGMVATDGEDRPLHPVTIYTATPLREPPLPKSERNTETTSLQ
IKAS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacacgaacgcgccctggacgcacgttgagttcgagacgtccattggttccttc
agcatcgaactgtaccacaagcatacaccgcgcacgtgttacaacattgccgctctggcg
taccaaggctactacaatggcaccattttccaccgcattattcgtgatttcatgatccaa
ggtggcgaccccacaggaacgggacgcggtggggaatctatctacgggggaaagtttgcc
gacgaaatcacgcgcaaccttaaacacgtgggtgccggggtcgtttccatggccaatgcc
ggtcccaacacgaatggatcgcaattttttatttcccttaaacccaccccctttttggac
ggaaagcataccgtgttgggtcgggtgtattccggtatgagtgttgtgcagcgcatgggg
atggtagcgacggacggagaggatcggccgctgcatcctgtgacgatctataccgctaca
ccgttgcgggaaccgccgctacccaagtcggaacgaaacaccgaaacgacttctttgcaa
ataaaagctagctag

DBGET integrated database retrieval system