KEGG   Phaeodactylum tricornutum: PHATRDRAFT_44806Help
Entry
PHATRDRAFT_44806  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00600  Sphingolipid metabolism
pti01100  Metabolic pathways
Module
pti_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PHATRDRAFT_44806
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     PHATRDRAFT_44806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 7199909
NCBI-ProteinID: XP_002178970
JGI: 44806
UniProt: B7FVQ2
Position
5
AA seq 585 aa AA seqDB search
MPAICCCCDSSAAVAVREDFATRDTSIGNSIIDPSLTRAFMNVPPHFASSSLATADWPTE
AANRLQLRAPSACKVSAEHCVLQYDTTKALLLVVTSTSTDDNRDGEQILDIIDPDDMIGV
KLEIQTTDRFGAARSTSQASAQGEENTFIRATNEPTTDGLADSRGSALLTLFVYPRKDPS
KPSFLNRYGVTTYKPKPDPKYARPTADTLSKLGFRHAHHRTFKLAPTEDLQDCSTVVAAL
RKLCSSQQPSAVSPLRYLIVVNPQSGPKRSGGKLCETQVQPMLEQAGIEVDVCITTHPNH
AQERMAKSSTEEDIAGYDGLVLMGGDGVVHEAYNGLFARADKDELLKKLKIGVIGCGSCN
GFSTSLAHGSHERYGIVAETFLVAKGQSCWHDTSRYQTTTKSYSSFLTFSWAIIADIDIE
SEVLHWLGEPRNDIWAVLRILALRRYQATFSYLPATEATADNTITIPALSDPVPSTWTTV
EDGFYLFWASHVTHAAMHTYHSPNSKFQDGIFEIMIVRGRVSRYRMTRILLALESGNHVG
MPGVEFVQCVAYRLVKETPGSFNDIDGEAVEDGPIQAQVQPHSVQ
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctatctgttgttgctgtgattcgtcggccgctgtagcagtaagagaagacttc
gcaactcgggacaccagcattggcaactccatcattgatcccagcttgacacgcgctttc
atgaatgttcctccacatttcgcatcgtccagcctggcaactgcagactggccgacggaa
gccgcgaaccggctgcagcttcgggcgccttccgcatgtaaagtgtccgccgagcattgt
gtgctacagtacgataccaccaaagcactattgctagtcgtgacgtccacatccacggac
gacaatcgtgacggtgagcaaatactggacatcatcgatccagatgacatgattggggtc
aaactggaaattcaaaccaccgatcgtttcggtgcagctagatcgacttcccaagcgagc
gctcaaggggaagagaacacattcattcgagccaccaacgaacctactactgacggcttg
gctgattctcgaggctccgcgcttttgacgctctttgtctaccctcgtaaggatccctct
aaaccatcattcttgaatcggtacggagttacgacctacaaaccgaaacctgatcccaag
tacgcacgtccgaccgctgacactttatctaaacttggctttcgacatgcgcatcatcgc
acgtttaagttggctcctaccgaagacctacaggactgttcgaccgtggtggctgcccta
cgtaagctatgctcctctcagcaaccgagcgctgtttctcctctgcgttatttgatcgtt
gtcaatccccaatcgggtccgaagcgcagtggaggaaaactatgcgaaacacaggttcag
cccatgctggagcaggctggaattgaagtcgatgtttgcatcacgacgcatccgaatcat
gctcaggaacgcatggcgaagtcgtctacggaagaggatattgctggctacgacggttta
gtgctcatgggcggcgacggtgttgtgcacgaagcatataatgggttgttcgcccgcgct
gataaggacgaactgctaaaaaaacttaagatcggtgtgattggatgtggttcctgtaac
ggcttttcgacgagtttggcccacggtagtcacgaacgttacggaattgtggccgaaacg
ttcttagtggccaagggccagtcctgttggcacgatacgtcgcggtaccaaactacaacc
aaatcctattcttcattcctgaccttttcgtgggcaattattgccgatatcgatatcgaa
tcggaagttttgcactggctgggcgaacctcgcaatgatatttgggccgtcttgcggata
ttggccctgcgccgctaccaagctaccttttcgtatttacccgccacggaggcgaccgcc
gataacaccatcacgataccggccttgtcggatccagtcccctcaacctggactactgtg
gaggatggtttttatctcttttgggcttcccatgtcacccacgccgccatgcacacgtat
cattcgccgaattcaaagtttcaggacggaatctttgaaatcatgattgtacgtggacga
gtttcacgatatcgcatgactcggattctgttggcgctggaatcgggcaatcatgtgggc
atgcccggcgtggagtttgtgcagtgtgtagcctatcgtctagtgaaggaaactccagga
tcgttcaacgatatcgacggagaggccgtggaggacgggccaattcaagcacaagttcaa
ccccactcggttcaa

DBGET integrated database retrieval system