KEGG   Phaeodactylum tricornutum: PHATRDRAFT_54265Help
Entry
PHATRDRAFT_54265  CDS       T01075                                 

Gene name
CaMK2
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
pti  Phaeodactylum tricornutum
Brite
KEGG Orthology (KO) [BR:pti00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pti01001]
    PHATRDRAFT_54265 (CaMK2)
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     PHATRDRAFT_54265 (CaMK2)
Protein kinases [BR:pti01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   PHATRDRAFT_54265 (CaMK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo
Motif
Other DBs
NCBI-GeneID: 7198099
NCBI-ProteinID: XP_002178623
JGI: 54265
UniProt: B7FUM4
Position
4
AA seq 325 aa AA seqDB search
MRFDELYRLKGVLGTGAFSTVREGFHRNNQKLSYAVKCINRKKLTEEDEAALLDEVSILK
EMEHSHIIRLYDFFEEPSTYYLVMERMRGGELFDRIVAKAYYNEKEARDTCKIVLEAVGY
CHQNHVAHRDLKPENLLLLSEHDDSAVKIADFGFAKKVYKHNCLTTQCGTPGYVAPEILE
GTPYDERADMWSVGVILYILLGGYPPFIESTQRDLFRKIRKGEYEFHEEYWGTVSTEAKD
LISSLLTVDCSTRLTAHQALENGWILGDDAKLASKDLGPNLKKLANFNAKRKLRAAVSAV
IAMNKLNFLSESFVKPGGKMTKDES
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcgatttgacgagttatacaggctgaagggtgtcctcggtaccggtgcattttcaact
gttcgtgaaggattccaccgaaacaaccaaaagctcagttatgcggtcaaatgtattaat
cgaaagaaacttacagaggaggatgaagctgctctgttagatgaggtgtcaatcctgaag
gaaatggagcattcacatatcattcgactatacgatttcttcgaagagcccagcacatac
tatttggtgatggaacgaatgcgtggaggcgagctgtttgaccgtattgttgccaaagca
tactacaacgagaaagaggcacgagacacctgtaagatcgtcttagaagctgttggctac
tgtcaccaaaaccatgttgcgcaccgggatctgaaaccggaaaatcttcttttactatcg
gagcacgatgattcagccgtcaagattgctgattttggttttgccaagaaagtctataag
cataattgcctgacgacacaatgtggcactccaggctatgtcgcgccagaaattttagag
ggaactccatacgatgagcgagctgatatgtggagtgtcggtgtaatcctttacattcta
ctcggaggttatcctccttttatcgaaagcactcaacgtgatttgtttcgtaaaatcaga
aagggggaatacgaattccacgaagagtattgggggacggtatcgactgaggcgaaggat
ctgatatcatcattgctcactgttgactgcagtacacgcctgactgctcaccaagctttg
gaaaacggatggattctaggcgacgacgccaagcttgcttcaaaagatttggggcccaat
ttgaagaagcttgccaacttcaatgccaaacggaagcttcgtgctgcagtttcggccgtg
attgccatgaacaagttaaacttcctttcggaaagctttgtcaagccgggcggtaaaatg
acgaaagacgagagctag

DBGET integrated database retrieval system