KEGG   Phaeodactylum tricornutum: PHATRDRAFT_9546Help
Entry
PHATRDRAFT_9546   CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00350  Tyrosine metabolism
pti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    PHATRDRAFT_9546
Enzymes [BR:pti01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     PHATRDRAFT_9546
Exosome [BR:pti04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PHATRDRAFT_9546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24
Motif
Other DBs
NCBI-GeneID: 7196257
NCBI-ProteinID: XP_002176577
JGI: 9546
UniProt: B7FRP5
Position
1
AA seq 191 aa AA seqDB search
DQVINLIDEFCYRRHWMMHVGPEKGKVLENHLAQCLDAHLLKNRAKPFLVLEVGTYCGYS
SIRMCRTILSKLMDANKCFHVMSVDVNPHSQMVAKQLVALAGLEAYVTFGLLTDLESNRD
ELSQSIWAQVDVFSTEYGSSGLDFVFLDHDKDMYLSDIVQLERAKLIRAGSFVAADNILF
FRLDDYQRHMQ
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gatcaagttataaatttgattgacgaattttgctatcgaagacattggatgatgcacgtg
gggcccgaaaaggggaaggttttggaaaatcatttagcgcagtgcttggatgcgcatctt
ttgaaaaatagagcgaagccttttcttgtcttggaggtcggaacgtattgcggatactcc
tctattcgaatgtgtcgcactatactctccaaattgatggacgccaataaatgttttcat
gttatgtcggtggatgtcaatcctcacagccagatggttgcaaagcaattggttgctttg
gcagggctagaagcatatgttaccttcgggctactgaccgatctagagtcgaatcgcgat
gagctgtcgcaatctatttgggcacaggtggacgtcttctccacagaatatggctcaagt
ggtttagactttgtttttctcgatcacgacaaagatatgtacctctcagatatagtccaa
ctggaacgagcgaaattgatccgcgctggaagcttcgtagccgctgacaacattttattt
tttcgtttggacgactatcagagacatatgcaa

DBGET integrated database retrieval system