KEGG   Phaeodactylum tricornutum: PHATR_52110Help
Entry
PHATR_52110       CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00564  Glycerophospholipid metabolism
pti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pti00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PHATR_52110
Enzymes [BR:pti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     PHATR_52110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 7204641
NCBI-ProteinID: XP_002185689
JGI: 52110
UniProt: B5Y3N6
Position
11
AA seq 427 aa AA seqDB search
GKGARLTDSNGVSYLDTRNNVAHVGHCHPTVVQAVQTQVAKLNTNSRYLHPIMTVLASRL
AELLPDPLEVVFFCNSGSEANDLALRLAKAYSYGHSNNTIVVGGAYHGHTLGTLEISPYK
YEHGTEFALQDSPVNQIPCPDTYRGRHRNPATAADDYAEYVQEACQYFKRKNESVRAFII
EGGMSVAGVILPPTGYLSACVKAVREAGGIYIADEVQTGFGRLGTSLWAFQHQQHDNHGL
ETVIPDIVTVGKPFGNGMPLAALITSRKVADAFDACGVEYFNTFGGNPVCAAAGMAVLDV
MDSEQLQAHALNVGFYLREGLVKLRERIHLIGDIRGSGLFIGVELVLDQATLEPATLQTS
FVCSVLKTKYHILTSIDGPHNNVLVIKPPLCFSEQDADFLLESLAQAATVDLASGSDSNA
LRKQTPT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ggtaaaggcgcgcgcttgaccgattcaaacggtgtgtcgtacctggatacgagaaataat
gtagctcacgtcggacactgccatcctactgtcgtccaagccgttcaaacgcaagtcgcg
aagcttaacacaaactcacgctatttacatcctattatgacggttctcgcgagtcggctt
gccgagcttttgccggatccgttagaagttgttttcttttgcaattctggaagcgaagcc
aacgacttggcgctacgtttggccaaggcctacagctatggtcacagcaacaacacgata
gttgtcggtggcgcatatcacggtcataccctaggaacgttggagatttctccttataag
tatgagcacggaaccgaatttgcgctccaagattcgccagtcaatcagattccatgtccc
gatacgtatcgtggtaggcatcggaatccagctactgccgcggacgactacgccgagtat
gttcaggaagcgtgtcagtattttaagagaaaaaacgaaagcgtgcgggccttcatcatc
gaaggcggcatgagtgtggctggtgtaatcctcccaccgacgggttatctatctgcttgt
gtcaaggctgtgcgggaggccggtggtatatacattgccgatgaagtacaaaccggcttt
ggccgactagggacgtcactttgggcctttcaacatcagcaacacgacaatcacggactc
gaaacggtcattccggatattgttaccgtgggcaaaccctttggtaacggcatgccctta
gcagctttaattaccagtcggaaagtggcggatgcatttgacgcatgcggagttgagtac
tttaatacttttggaggcaatccggtttgcgccgctgctggtatggccgtgctggatgta
atggactctgagcaattgcaagcgcatgctttaaatgtgggtttttacctacgtgaagga
ctcgtcaagttacgagaacggatacatctgattggggacattcgcgggtcgggtttgttc
ataggcgtggagctagtgttggatcaagcgacgctggaaccagcaaccctgcaaacttcg
tttgtgtgctccgttctaaaaaccaaataccacattctgaccagcatagatggcccacac
aacaacgttttggtgatcaagcctcctctttgttttagcgagcaagatgcagatttcctt
ttggagtcgcttgcccaggccgccactgtggaccttgcttcggggagtgactccaatgcc
ttaaggaaacaaactccaacttag

DBGET integrated database retrieval system