KEGG   Parageobacillus thermoglucosidasius DSM 2542: AOT13_03670Help
Entry
AOT13_03670       CDS       T04476                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ptl  Parageobacillus thermoglucosidasius DSM 2542
Pathway
ptl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ptl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AOT13_03670
Enzymes [BR:ptl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AOT13_03670
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AOT13_03670
    1.1.1.-  
     AOT13_03670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_zinc_N_2 2-Hacid_dh_C ADH_N_assoc BRCA2 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ALF09196
UniProt: A0A369XGJ9
Position
739611..740663
Genome map
AA seq 350 aa AA seqDB search
MKAARWYNARDIRVEEVEEPKAGKGKVKIKVEWAGICGSDLHEYAAGPIFIPVQNPHPVS
KDVAPIIMGHEFSGRVVEVGEGVTKVKVGDPVVVEPILRCGECPACKKGKYNLCEHLGFH
GLSGGGGGFSEYTVVDEYMVHKMPEGLSFEQGALVEPAAVALHAVRSSKIKPGDKAAVFG
TGPIGLLVMEALKAAGASEIYAVEVSKERLQKAKELGATSVINPKEEDPVRKLVELTGGG
VDVAFEVTGVPAVLQQAIDSTAFEGETVIVSIWEKEASIQPNNIVLKERNVKGVIAYRDI
FPAVMELMKRGYFQAEKLVTKRIKLDDIVAEGFEALIKEKDQVKILVKPE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgcgatggtacaatgctagagacattcgagtggaagaagtagaagaaccg
aaagcaggaaaaggaaaagtaaaaattaaagtcgaatgggcgggaatttgcggaagcgat
ttgcacgaatatgcggcaggtccaatttttattcctgtccaaaatcctcatcccgttagt
aaagatgtcgccccgattatcatgggccacgaattttcgggccgagtagtagaagtcggg
gaaggagttactaaagtcaaagttggggatcctgtcgttgttgaaccgattcttcgttgt
ggagaatgcccggcttgcaaaaaagggaaatacaatctttgcgaacatttaggattccat
ggcctgtccggaggaggcggcggattctcagaatataccgtcgttgatgaatatatggtg
cacaaaatgcctgaaggtctttcttttgaacaaggagcgctagtggaaccggcggctgtc
gcgttacatgctgtcagatcaagcaaaatcaaacctggtgataaagctgccgtttttgga
acaggaccgataggccttcttgtgatggaagcattgaaagcggctggcgcctcggaaatt
tatgcagtcgaagtttccaaagaacgtttgcaaaaagcgaaagagcttggcgccacatct
gtcatcaatccaaaagaagaagatccggttcgcaaacttgtcgaattgaccggtggcggc
gtcgatgttgcgtttgaagtaacgggggtgccggccgttttgcagcaagctattgacagc
actgcattcgaaggagaaacggttatcgttagtatatgggaaaaagaagcaagcattcag
ccaaacaatattgtattaaaagaaagaaatgtgaagggagttattgcataccgcgatatt
ttccctgctgtaatggaattaatgaaacgaggctatttccaagccgaaaagcttgttacg
aaacgaatcaagctggatgatatcgtggcagaaggatttgaagcgctcattaaagaaaaa
gaccaagtgaaaattttggtcaaaccagaataa

DBGET integrated database retrieval system