KEGG   Parageobacillus thermoglucosidasius DSM 2542: AOT13_11050Help
Entry
AOT13_11050       CDS       T04476                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ptl  Parageobacillus thermoglucosidasius DSM 2542
Pathway
ptl00071  Fatty acid degradation
ptl00072  Synthesis and degradation of ketone bodies
ptl00280  Valine, leucine and isoleucine degradation
ptl00310  Lysine degradation
ptl00362  Benzoate degradation
ptl00380  Tryptophan metabolism
ptl00620  Pyruvate metabolism
ptl00630  Glyoxylate and dicarboxylate metabolism
ptl00640  Propanoate metabolism
ptl00650  Butanoate metabolism
ptl00900  Terpenoid backbone biosynthesis
ptl01100  Metabolic pathways
ptl01110  Biosynthesis of secondary metabolites
ptl01120  Microbial metabolism in diverse environments
ptl01130  Biosynthesis of antibiotics
ptl01200  Carbon metabolism
ptl01212  Fatty acid metabolism
ptl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ptl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOT13_11050
   00630 Glyoxylate and dicarboxylate metabolism
    AOT13_11050
   00640 Propanoate metabolism
    AOT13_11050
   00650 Butanoate metabolism
    AOT13_11050
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOT13_11050
   00072 Synthesis and degradation of ketone bodies
    AOT13_11050
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOT13_11050
   00310 Lysine degradation
    AOT13_11050
   00380 Tryptophan metabolism
    AOT13_11050
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AOT13_11050
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOT13_11050
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AOT13_11050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptl04147]
    AOT13_11050
Enzymes [BR:ptl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AOT13_11050
Exosome [BR:ptl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOT13_11050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: ALF10506
Position
2241159..2242415
Genome map
AA seq 418 aa AA seqDB search
MELAISQRRNDVVKGGRIRIMTGVVIVDAVRTAIGKMGGTLKNVEVDYLAAKVIDEVLKR
NGIEGSEVDEVIMGQAKQSTDAPNMARVALLRAGLPVEVPGYTVHRQCGSGLQAINNAAQ
QIQCGLASIIVAGGAESMSTAPYYIRGARYGLEAGNGLLLDPNTESQPRSQPPEIYGKDL
TMGLTAEILAEKYQISRQEQDEFAFLSQSRAAYAISSGKFENEIVPFEVKLKKEMIHFKI
DEHPRLTPVEKLLTLPPVFKKDGTVTAGNSSGRNDGAAAVLVMSEIEAEKRGLKPKARIL
AQAVSGVSPEIMGIGPVPATRKALKMAGLQLEDIDLIELNEAFAAQSLAVIKELGLRLEK
VNVNGGAIALGHPVGATGAILMTKLIHEMERRGSRYGLVTLCIGGGQGITTIVENLRR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggaattagcgatttctcaaaggcgtaacgatgtggtaaagggagggagaataagaata
atgactggagttgtgattgtagacgctgtacgtacagcgatcggaaaaatgggcggcacg
ttaaaaaatgtagaagtggattatctagctgccaaggtgattgacgaagttctcaagaga
aacggaatagaaggctccgaagttgacgaagtgatcatggggcaagctaagcaaagtacc
gatgcgccaaatatggctcgtgttgcattgcttcgtgcggggctgccggtggaagttccc
gggtatacggttcaccgccaatgcggatcagggctacaggcgatcaataatgcggcacag
caaattcagtgcgggcttgcaagcatcattgtagcaggtggagcggaaagcatgagcaca
gcaccgtattatattcgaggcgcacggtacggccttgaagcaggcaacggcctcttgctg
gatccgaatacagaaagccaacctcgttctcaaccgcccgaaatctatggaaaggatttg
acgatgggactcacggcggaaattttagctgaaaaatatcaaatcagccggcaagagcag
gatgaatttgctttcctcagtcaaagccgggctgcctatgcgatttcgtctggtaaattt
gaaaatgaaattgtgccttttgaggtcaagctaaaaaaagaaatgatccattttaagatt
gatgagcatccgcgtctgactccggttgagaaattactcaccttgcctccagtctttaaa
aaagatgggacggtaactgccgggaactccagtggtcggaatgacggtgccgcagcggtt
ttagtcatgtcggagatagaggcggagaaacgaggtcttaagccgaaagcacggatcctc
gcacaggctgtgtctggagtgtcgccggaaattatgggaatcgggccggtgccagcgact
cgtaaggctttgaaaatggccggattgcagttagaagacattgacctgattgagttgaac
gaagcgtttgcagctcaatccctcgccgtcattaaagaattgggcctgagactggaaaag
gtaaacgtaaacggcggagctatcgcattagggcatcctgttggtgcgaccggcgctatc
ttgatgactaaactgatccatgaaatggagcggcggggttcgcgttacggactggtcacc
ctgtgcatcggaggcggtcagggaatcaccaccattgttgaaaacctgcggcgataa

DBGET integrated database retrieval system