KEGG   Parageobacillus thermoglucosidasius DSM 2542: AOT13_14335Help
Entry
AOT13_14335       CDS       T04476                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
ptl  Parageobacillus thermoglucosidasius DSM 2542
Pathway
ptl00330  Arginine and proline metabolism
ptl00360  Phenylalanine metabolism
ptl00380  Tryptophan metabolism
ptl00627  Aminobenzoate degradation
ptl00643  Styrene degradation
ptl01100  Metabolic pathways
ptl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ptl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AOT13_14335
   00360 Phenylalanine metabolism
    AOT13_14335
   00380 Tryptophan metabolism
    AOT13_14335
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AOT13_14335
   00643 Styrene degradation
    AOT13_14335
Enzymes [BR:ptl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     AOT13_14335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ALF11094
UniProt: A0A369WX77
Position
complement(2928621..2930144)
Genome map
AA seq 507 aa AA seqDB search
MAVKKPTIEQLKRIAEKFDLDLTTNELSLYQELIEGTLESYHRLNQLVEPSLPVKYPRTP
GYRPSAEENPYNAWYWKTSIKGNSTGKLTGKTIVLKDNISLAGVPMMNGSAILEGFVPDE
DATIVTRILDAGGEIVGKAVCEDLCLSGGSHTSATGPVLNPHDPTRSSGGSSSGCAALVA
AGEVDMAIGGDQGGSIRIPSSWSGVYGLKPTYGLVPYTGIFPIEQTIDHTGPIARTVEDV
ALLLEVIAGEDGLDPRQSGLEVKPYTKSLVGHAKDMKIGIVTEGFGWDGLSEEDVDHLVR
EAAYSLENSGATVEEVSIPMHRDGIHIWNGIGIEGLTSLMVKGNGMGTNWKGHYSTKLLD
AYGKARKIRANEFSDTVKMTILLGQYMQDQYNGKYYAIAQNLARTLKQAYDHALKTYDVL
IMPTTPMKATKIPSSDASKEEIITRALEMIYNTAPFNVTGHPAMNVPCGKSEGLPVGMMI
VGRHGEDDMVLRVAHAFQSTHERVATI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggctgttaaaaaaccaacgattgaacaattaaaaagaattgcagagaagtttgatctt
gacctcacaacgaatgaattatctttatatcaagaattaatagaagggacacttgaatcc
taccatcgtttaaaccagcttgtagaaccaagtctcccagtaaaatatccacgcactcca
gggtatcgtccaagcgctgaggaaaacccgtacaatgcatggtattggaaaactagcatc
aaaggaaacagcacaggaaaattaacgggaaaaacaattgttctaaaagataatatcagt
ctagcaggtgttcctatgatgaatggttccgctatccttgaaggttttgtacctgacgaa
gacgctaccattgtaactaggatactggatgctggcggagaaattgtaggcaaagcggtt
tgcgaggatttgtgcctatctggaggcagtcacacttctgcaacaggccccgttttaaat
ccacacgaccctaccagatcatcaggtggttcttctagtggctgtgcagcattggtcgct
gctggtgaagtggacatggcaatcggcggtgaccaaggaggatctattcgaattccgagc
tcctggtctggtgtatatggtcttaagcctacatacggacttgttccttataccgggatt
tttccgattgaacagacgatcgatcacactggccctattgcgagaacggtggaggatgtt
gccttattgcttgaagtgatcgcgggggaagatggattagatccaaggcagtccggttta
gaagtgaaaccatacacaaaatcacttgttggtcatgcgaaggatatgaaaatcggaatc
gtaacggaaggctttggctgggacgggctgtccgaggaagatgtggatcatttagtaaga
gaagccgcgtattctttggaaaacagtggagcaacagtggaagaagtatcgattcccatg
catcgggatggcattcacatctggaacgggattggcatagaggggcttacttccttaatg
gtcaaaggcaatggcatgggaacgaattggaagggacattatagtacgaaacttcttgat
gcctatgggaaagcacgcaaaatacgagccaatgaattttccgatacagtgaaaatgaca
atcttgcttggacagtatatgcaggatcaatataacgggaaatattacgcgatcgcacaa
aatctggctcgaacattaaaacaagcctatgatcatgcactaaaaacatatgatgtgctg
attatgccaacaacaccgatgaaggcgacaaaaattccttcttccgatgcttcaaaggaa
gaaattataacgagagctttagaaatgatttataatactgcaccattcaatgttacagga
cacccagccatgaacgtcccgtgcggaaaatccgaagggctgcctgtcgggatgatgatc
gttggaagacatggcgaagatgacatggttttgcgtgttgctcatgcctttcagtcgaca
catgaacgtgttgctacaatataa

DBGET integrated database retrieval system