KEGG   Paramecium tetraurelia: GSPATT00000510001Help
Entry
GSPATT00000510001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GSPATT00000510001
Enzymes [BR:ptm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     GSPATT00000510001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 5009256
NCBI-ProteinID: XP_001423472
Genoscope: GSPATT00000510001
UniProt: Q6BGH8
Position
undetermined
AA seq 588 aa AA seqDB search
MGCGSSSGSQLETRGLIYIYYGTTTGNSSRLAFQFASEVRNLKFIPKIINLSEYNPKEMI
SSKLNVFFVSTYGMGSCTPDTENFDQWLFCEERSKNEFQGMIYLIFALGSTNHEHFCEFG
IRLDKRLEYLGAKRLCNLGKGDAAKDQTENDYQQWIHTEVQQTLQTQFPLYTCDQGQQDF
STIKIQITKEPEDFQSVNLDFMALKYINSMAFSISEIKELKALPARGNSTLLLDLFNQNI
EYKTAYNIAIYPQNSDSDVDELCSLLKLDKNVRFKVITNSKQPFPNPISVYTYLKKFCDF
SGLVTKKILIELSNLVNQKQLEDELLHLASFEGRDQYQNRFINQKQNLLNLIKEYQINNL
TLEKIIDICPLIQPRYFTIASSNKKHPKNIHILASQFVLNQERLGLSSQFFRSLKKGDVV
KGLIQPSKFKYPKNPKAPILLIGIGAGLAPLRALIQERDYYLEKNQFEKCPFQGGMKLYY
GCRTEAEYLCREELQAYLNSGTLSELKVAFSRKEPKQYVTELIAIDELYQHFQMDGLLYI
CGSTELGRDIQVKIADMFEYFENIDPYLTDQKIKELEENSQILTEYWG
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtggttcgtcatctggaagttaattagaaacaaggggtctaatctatatttat
tatggcacaacaactgggaattcgagcagattagccttttaatttgccagtgaagtcaga
aatcttaaatttattcctaaaattatcaatcttagcgaatacaatcccaaagaaatgata
tcttcgaaattaaatgttttttttgtatccacatatggaatgggatcatgtacacctgat
actgaaaactttgaccaatggttattttgcgaagaaagaagtaaaaacgaattttaaggg
atgatttatttaatctttgcattggggagtactaatcatgaacacttttgtgaatttgga
ataagactggataaaagattggaatatttaggtgcgaaaagattatgtaatttgggtaaa
ggggatgctgcaaaggattaaaccgaaaacgactattaataatggattcatactgaggtg
caatagactttgcaaacataattccctttgtacacatgtgattaaggttaataggatttt
tcaactatcaaaatttaaataactaaggaaccagaagatttttagagtgtcaatcttgat
ttcatggctctaaaatatattaacagtatggcattctctataagtgaaatcaaagaatta
aaagccttacctgctagaggcaattctacattattgttagatctcttcaatcaaaacatt
gagtacaaaactgcttacaatatagctatctatcctcagaattctgattctgatgtagat
gagctgtgctctttacttaaactcgataaaaatgtgagatttaaagtaatcaccaactcg
aaatagccattccctaatccaatttccgtttatacatatttaaaaaaattttgtgatttt
tctggcttagttacaaagaaaatattaattgaactttcaaatttggttaatcaaaaacaa
ctagaagatgaactccttcatcttgcctcatttgaaggaagagatcaatattaaaataga
ttcataaattaaaagcagaatttacttaatttaataaaagaatatcaaatcaacaactta
accttagagaaaatcattgacatatgccctttaattcaaccaagatactttacaatagca
tcaagcaataagaaacatccaaagaatattcacatattggctagtcaatttgtattgaat
caagaaagattaggactttcaagctaatttttcagatctttaaaaaaaggagatgttgtt
aaaggattaatctagccatctaaatttaagtatcctaaaaacccaaaagcacctatactt
ctaattggaattggagctggattggcacccctcagagcccttattcaggagagggattat
tacttagaaaaaaaccaatttgaaaagtgcccattttaaggaggaatgaaattatactat
ggatgtcgaacagaagctgagtatttatgtagggaggaactttaagcttatctaaattca
ggaacgctaagtgaattaaaagtagccttttcaagaaaggaacctaaacagtatgtcaca
gaattaattgctattgatgaattatattagcatttctagatggatggattactatacatt
tgtggatctactgaattgggaagagacattcaagtcaaaatagctgatatgtttgaatat
tttgagaatattgatccctatttgactgattaaaaaataaaagaactcgaggaaaattca
taaatattaacggaatattggggttga

DBGET integrated database retrieval system