KEGG   Paramecium tetraurelia: GSPATT00000704001Help
Entry
GSPATT00000704001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptm01001]
    GSPATT00000704001
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptm03036]
    GSPATT00000704001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     GSPATT00000704001
Protein kinases [BR:ptm01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   GSPATT00000704001
Chromosome and associated proteins [BR:ptm03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    GSPATT00000704001
   Centrosome duplication proteins
    Regulators of centriole replication
     GSPATT00000704001
  Sister chromatid separation proteins
   Polo kinases
    GSPATT00000704001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal VP4_2
Motif
Other DBs
NCBI-GeneID: 5024174
NCBI-ProteinID: XP_001438389
Genoscope: GSPATT00000704001
UniProt: A0CJM5
Position
undetermined
AA seq 594 aa AA seqDB search
MLNGKQIGDYVLMEELGRGSFGCVYKCQNIIDQSFHAIKIIQFQSLSNCEGVVGELLKDE
ISVLTKIDSPNVLKLEHYFQSKSNCYIVMEYCNGGDLERYWTREGKRIKEQKALEIVIQI
LNGLSELHKQNVIHRDIKLANILMHNDQIKIADLGFCKQLQNQEMEVSLCLGTPGTMAPE
VASFESYGLQSDIFSIGCIFYQLLYGELPFDYSILQYHNHSMLEQIDFNKNNVVIQDELK
EIISKMLKDEPKKRLTFPQLYQYPLFRNTQKMSQVSKIAIQNMTNPETTNYYEEIYKNQQ
DIQIGQQGMTALKQNGDIFKTQTEKQNQQSQFMSNLQNANNSNRNLFVQDQVSKLTYEIM
AAQQLRPNQQQINNALQELQDNEQIFKTDRFKHNYSMTANSQQNQKLCQQFRFLLDALQY
CDRTYIEIDQIQFLDESQTLIGKFMIQKRIRSESKKFFQVQQENPFYDELNQMGEAFKPY
VQNQLFEKLHQQIISSSSLLSRLTQPFINELKDEETGIFHLHYWEALNELHQLIKKEINR
EADNKRKKILVIALLHLQGCMHFQDLCTLKIDFEEEFLHIKKKNLIELIKKVQY
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatggaaaataaattggagattacgtgcttatggaagaattaggcaggggctcc
tttggctgtgtttacaaatgctagaacattatcgattaatcatttcatgcaataaagatt
atccaatttcaatctttgagcaattgcgaaggagttgttggtgaattattaaaggacgag
ataagtgtactgactaaaatagattcgcctaatgttttgaaattggaacactacttttaa
tcaaaaagtaattgctatattgtaatggaatattgtaatggaggggatttagaaaggtac
tggaccagggaaggtaaaagaataaaggaacagaaagcactagaaatcgttatccagatt
ctgaatggattgagtgaattacataaatagaatgtgatacatagagacataaaattggcc
aatattttgatgcataatgatcaaattaaaattgccgatcttggattctgtaagcaattg
caaaactaggaaatggaggttagcttatgtttgggtacaccaggcacgatggcaccggaa
gtagcctcattcgagagttatggcttacaatcagacatcttttcgatagggtgcatcttc
tatcaacttttatatggtgaattgccctttgactattcgatattgtaatatcataaccat
tctatgttagagtaaatcgacttcaataagaataacgtcgtgatccaggatgaattaaag
gagattattagcaagatgttgaaagatgaacccaaaaagagattaaccttcccccaatta
tatcaatatcctcttttcaggaacacacaaaaaatgtcttaagtaagtaaaattgcaatt
caaaatatgacgaatccagaaactactaactactatgaagaaatttataaaaatcaacag
gatattcagataggatagtaaggcatgaccgccttgaaatagaatggagacatctttaaa
acttaaactgagaagcaaaactagtaatctcagtttatgagtaatctatagaatgcgaat
aatagcaatcgcaatctttttgtataggatcaagtatcaaagctgacatatgaaattatg
gcagcccaataattgcgtccaaatcaataataaattaataatgctttataggaactctaa
gataatgagtagatattcaaaactgacagattcaagcataattatagcatgactgctaat
agttaatagaatcagaagttatgtcagcaatttcgtttccttttggatgccttataatat
tgcgatagaacatacattgaaatcgatcaaatctaattcttagatgaaagctagactttg
ataggcaaattcatgatccaaaagagaataagatctgaaagcaagaagtttttctaggtt
taacaagagaacccattctatgatgaattgaattaaatgggagaagccttcaaaccttat
gtctaaaatcaactgtttgaaaaattgcatcagcagatcataagttcttcttcccttctt
agtagattaacacagcccttcataaatgagttgaaggatgaagaaacaggaatattccac
ttgcactattgggaagcattaaatgaattgcatcaattaatcaaaaaagaaatcaatagg
gaagcggacaacaaaagaaagaagattttagtgatcgcgttgcttcatttataaggatgc
atgcatttccaagatctgtgtactttgaaaatagattttgaggaagagtttttacacata
aaaaagaaaaatttgattgagttgatcaagaaagtttaatattga

DBGET integrated database retrieval system